Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Granulocyte colony-stimulating factor receptor (G-CSF receptor) (G-CSF-R) (CD antigen CD114)

 CSF3R_HUMAN             Reviewed;         836 AA.
Q99062;
01-FEB-1995, integrated into UniProtKB/Swiss-Prot.
01-FEB-1995, sequence version 1.
12-SEP-2018, entry version 186.
RecName: Full=Granulocyte colony-stimulating factor receptor;
Short=G-CSF receptor;
Short=G-CSF-R;
AltName: CD_antigen=CD114;
Flags: Precursor;
Name=CSF3R; Synonyms=GCSFR;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4).
TISSUE=Placenta;
PubMed=2147944; DOI=10.1084/jem.172.6.1559;
Larsen A., Davis T., Curtis B.M., Gimpel S., Sims J.E., Cosman D.,
Park L., Sorensen E., March C.J., Smith C.A.;
"Expression cloning of a human granulocyte colony-stimulating factor
receptor: a structural mosaic of hematopoietin receptor,
immunoglobulin, and fibronectin domains.";
J. Exp. Med. 172:1559-1570(1990).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
TISSUE=Placenta;
PubMed=1701053; DOI=10.1073/pnas.87.22.8702;
Fukunaga R., Seto Y., Mizushima S., Nagata S.;
"Three different mRNAs encoding human granulocyte colony-stimulating
factor receptor.";
Proc. Natl. Acad. Sci. U.S.A. 87:8702-8706(1990).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=1530796;
Seto Y., Fukunaga R., Nagata S.;
"Chromosomal gene organization of the human granulocyte colony-
stimulating factor receptor.";
J. Immunol. 148:259-266(1992).
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS THR-231; ASN-320;
ARG-346; LYS-405; GLN-440; HIS-510; HIS-562 AND CYS-583.
SeattleSNPs variation discovery resource;
Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Blood;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
PROTEIN SEQUENCE OF 234-269.
PubMed=8554326; DOI=10.1006/abbi.1995.0047;
Haniu M., Horan T., Arakawa T., Le J., Katta V., Rohde M.F.;
"Extracellular domain of granulocyte-colony stimulating factor
receptor. Interaction with its ligand and identification of a domain
in close proximity of ligand-binding region.";
Arch. Biochem. Biophys. 324:344-356(1995).
[7]
DOMAINS.
PubMed=1717255;
Fukunaga R., Ishizaka-Ikeda E., Pan C.-X., Seto Y., Nagata S.;
"Functional domains of the granulocyte colony-stimulating factor
receptor.";
EMBO J. 10:2855-2865(1991).
[8]
FUNCTION, AND POSSIBLE ASSOCIATION WITH SCN.
PubMed=7514305; DOI=10.1073/pnas.91.10.4480;
Dong F., Hoefsloot L.H., Schelen A.M., Broeders C.A., Meijer Y.,
Veerman A.J., Touw I.P., Lowenberg B.;
"Identification of a nonsense mutation in the granulocyte-colony-
stimulating factor receptor in severe congenital neutropenia.";
Proc. Natl. Acad. Sci. U.S.A. 91:4480-4484(1994).
[9]
REVIEW.
PubMed=17127321; DOI=10.2741/2103;
Touw I.P., van de Geijn G.J.;
"Granulocyte colony-stimulating factor and its receptor in normal
myeloid cell development, leukemia and related blood cell disorders.";
Front. Biosci. 12:800-815(2007).
[10]
POSSIBLE ASSOCIATION WITH SCN.
PubMed=19120359; DOI=10.1111/j.1365-2141.2008.07425.x;
Zeidler C., Germeshausen M., Klein C., Welte K.;
"Clinical implications of ELA2-, HAX1-, and G-CSF-receptor (CSF3R)
mutations in severe congenital neutropenia.";
Br. J. Haematol. 144:459-467(2009).
[11]
STRUCTURE BY NMR OF 227-334.
PubMed=9187659; DOI=10.1038/nsb0697-498;
Yamasaki K., Naito S., Anaguchi H., Ohkubo T., Ota Y.;
"Solution structure of an extracellular domain containing the WSxWS
motif of the granulocyte colony-stimulating factor receptor and its
interaction with ligand.";
Nat. Struct. Biol. 4:498-504(1997).
[12]
3D-STRUCTURE MODELING OF 125-331.
PubMed=9368043; DOI=10.1074/jbc.272.47.29735;
Layton J.E., Iaria J., Smith D.K., Treutlein H.R.;
"Identification of a ligand-binding site on the granulocyte colony-
stimulating factor receptor by molecular modeling and mutagenesis.";
J. Biol. Chem. 272:29735-29741(1997).
[13]
X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 25-333 IN COMPLEX WITH CSF3,
GLYCOSYLATION AT ASN-134, DISULFIDE BONDS, AND SUBUNIT.
PubMed=16492764; DOI=10.1073/pnas.0511264103;
Tamada T., Honjo E., Maeda Y., Okamoto T., Ishibashi M., Tokunaga M.,
Kuroki R.;
"Homodimeric cross-over structure of the human granulocyte colony-
stimulating factor (GCSF) receptor signaling complex.";
Proc. Natl. Acad. Sci. U.S.A. 103:3135-3140(2006).
[14]
INVOLVEMENT IN SEVERE CONGENITAL NEUTROPENIA, VARIANT HIS-229, AND
CHARACTERIZATION OF VARIANT HIS-229.
PubMed=10449521; DOI=10.1084/jem.190.4.497;
Ward A.C., van Aesch Y.M., Gits J., Schelen A.M., de Koning J.P.,
van Leeuwen D., Freedman M.H., Touw I.P.;
"Novel point mutation in the extracellular domain of the granulocyte
colony-stimulating factor (G-CSF) receptor in a case of severe
congenital neutropenia hyporesponsive to G-CSF treatment.";
J. Exp. Med. 190:497-507(1999).
[15]
VARIANT NEUTROPHILIA ASN-640.
PubMed=19620628; DOI=10.1084/jem.20090693;
Plo I., Zhang Y., Le Couedic J.P., Nakatake M., Boulet J.M., Itaya M.,
Smith S.O., Debili N., Constantinescu S.N., Vainchenker W.,
Louache F., de Botton S.;
"An activating mutation in the CSF3R gene induces a hereditary chronic
neutrophilia.";
J. Exp. Med. 206:1701-1707(2009).
[16]
INVOLVEMENT IN SCN7, VARIANT SCN7 CYS-308, CHARACTERIZATION OF VARIANT
SCN7 CYS-308, SUBCELLULAR LOCATION, AND GLYCOSYLATION.
PubMed=24753537; DOI=10.1182/blood-2013-11-535419;
Triot A., Jaervinen P.M., Arostegui J.I., Murugan D., Kohistani N.,
Dapena Diaz J.L., Racek T., Puchalka J., Gertz E.M., Schaeffer A.A.,
Kotlarz D., Pfeifer D., Diaz de Heredia Rubio C., Ozdemir M.A.,
Patiroglu T., Karakukcu M., Sanchez de Toledo Codina J., Yaguee J.,
Touw I.P., Unal E., Klein C.;
"Inherited biallelic CSF3R mutations in severe congenital
neutropenia.";
Blood 123:3811-3817(2014).
[17]
INVOLVEMENT IN SCN7.
PubMed=26324699; DOI=10.1182/blood-2015-07-661264;
Klimiankou M., Klimenkova O., Uenalan M., Zeidler A.,
Mellor-Heineke S., Kandabarau S., Skokowa J., Zeidler C., Welte K.;
"GM-CSF stimulates granulopoiesis in a congenital neutropenia patient
with loss-of-function biallelic heterozygous CSF3R mutations.";
Blood 126:1865-1867(2015).
-!- FUNCTION: Receptor for granulocyte colony-stimulating factor
(CSF3), essential for granulocytic maturation. Plays a crucial
role in the proliferation, differientation and survival of cells
along the neutrophilic lineage. In addition it may function in
some adhesion or recognition events at the cell surface.
{ECO:0000269|PubMed:7514305}.
-!- SUBUNIT: Homodimer. The dimeric receptor binds two CSF3 molecules.
Interacts with CEACAM1; down-regulates the CSF3R-STAT3 pathway
through recruitment of PTPN6 that dephosphorylates CSF3R (By
similarity). {ECO:0000250|UniProtKB:P40223,
ECO:0000269|PubMed:16492764}.
-!- INTERACTION:
P40763:STAT3; NbExp=4; IntAct=EBI-7331284, EBI-518675;
P0CG48:UBC; NbExp=2; IntAct=EBI-7331284, EBI-3390054;
-!- SUBCELLULAR LOCATION: Isoform 2: Secreted {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:24753537};
Single-pass type I membrane protein {ECO:0000255}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Comment=Additional isoforms seem to exist. Experimental
confirmation may be lacking for some isoforms.;
Name=1; Synonyms=GCSFR-1;
IsoId=Q99062-1; Sequence=Displayed;
Name=2; Synonyms=GCSFR-2;
IsoId=Q99062-2; Sequence=VSP_001674;
Name=3; Synonyms=GCSFR-3;
IsoId=Q99062-3; Sequence=VSP_001673;
Name=4; Synonyms=GCSFR-4, D7;
IsoId=Q99062-4; Sequence=VSP_001671, VSP_001672;
-!- TISSUE SPECIFICITY: One or several isoforms have been found in
myelogenous leukemia cell line KG-1, leukemia U-937 cell line, in
bone marrow cells, placenta, and peripheral blood granulocytes.
Isoform GCSFR-2 is found only in leukemia U-937 cells. Isoform
GCSFR-3 is highly expressed in placenta.
-!- DOMAIN: The WSXWS motif appears to be necessary for proper protein
folding and thereby efficient intracellular transport and cell-
surface receptor binding. {ECO:0000269|PubMed:1717255}.
-!- DOMAIN: The box 1 motif is required for JAK interaction and/or
activation. {ECO:0000269|PubMed:1717255}.
-!- PTM: N-glycosylated. {ECO:0000269|PubMed:24753537}.
-!- DISEASE: Hereditary neutrophilia (NEUTROPHILIA) [MIM:162830]: A
form of lifelong, persistent neutrophilia, a condition
characterized by an increase in the number of neutrophils in the
blood. {ECO:0000269|PubMed:19620628}. Note=The disease is caused
by mutations affecting the gene represented in this entry.
-!- DISEASE: Neutropenia, severe congenital 7, autosomal recessive
(SCN7) [MIM:617014]: A form of severe congenital neutropenia, a
disorder of hematopoiesis characterized by maturation arrest of
granulopoiesis at the level of promyelocytes with peripheral blood
absolute neutrophil counts below 0.5 x 10(9)/l and early onset of
severe bacterial infections. {ECO:0000269|PubMed:24753537,
ECO:0000269|PubMed:26324699}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- MISCELLANEOUS: Mutations in CSF3R acquired in multipotent
hematopoietic progenitor cells and resulting in truncated hyper-
responsive forms of the receptor, have been identified in most
cases of severe congenital neutropenia (SCN). Patients carrying
these mutations are at risk for developing myelodysplastic
syndromes and/or acute myeloid leukemia. Constitutive mutations
leading to hyporesponsive forms of the receptor are responsible
for the refractoriness to CSF3 treatment observed in some SCN
patients.
-!- SIMILARITY: Belongs to the type I cytokine receptor family. Type 2
subfamily. {ECO:0000305}.
-!- WEB RESOURCE: Name=SeattleSNPs;
URL="http://pga.gs.washington.edu/data/csf3r/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; X55721; CAA39253.1; -; mRNA.
EMBL; X55720; CAA39252.1; -; mRNA.
EMBL; M59818; AAA63176.1; -; mRNA.
EMBL; M59819; AAA63177.1; -; mRNA.
EMBL; M59820; AAA63178.1; -; mRNA.
EMBL; S71484; AAB20660.1; -; Genomic_DNA.
EMBL; AY148100; AAN05790.1; -; Genomic_DNA.
EMBL; BC053585; AAH53585.1; -; mRNA.
CCDS; CCDS412.1; -. [Q99062-4]
CCDS; CCDS413.1; -. [Q99062-1]
CCDS; CCDS414.1; -. [Q99062-3]
PIR; B38252; B38252.
PIR; C38252; C38252.
PIR; JH0329; JH0329.
RefSeq; NP_000751.1; NM_000760.3. [Q99062-1]
RefSeq; NP_724781.1; NM_156039.3. [Q99062-3]
RefSeq; NP_758519.1; NM_172313.2. [Q99062-4]
RefSeq; XP_011539050.1; XM_011540748.2. [Q99062-3]
RefSeq; XP_016855859.1; XM_017000370.1. [Q99062-3]
UniGene; Hs.524517; -.
PDB; 1AZ7; Model; -; A=125-331.
PDB; 2D9Q; X-ray; 2.80 A; B=25-332.
PDBsum; 1AZ7; -.
PDBsum; 2D9Q; -.
ProteinModelPortal; Q99062; -.
SMR; Q99062; -.
BioGrid; 107828; 13.
CORUM; Q99062; -.
DIP; DIP-5788N; -.
ELM; Q99062; -.
IntAct; Q99062; 3.
MINT; Q99062; -.
STRING; 9606.ENSP00000362195; -.
BindingDB; Q99062; -.
ChEMBL; CHEMBL1996; -.
DrugBank; DB05249; FavId.
DrugBank; DB00099; Filgrastim.
DrugBank; DB09560; Filgrastim-sndz.
DrugBank; DB13144; Lenograstim.
DrugBank; DB00019; Pegfilgrastim.
iPTMnet; Q99062; -.
PhosphoSitePlus; Q99062; -.
BioMuta; CSF3R; -.
DMDM; 729564; -.
PaxDb; Q99062; -.
PeptideAtlas; Q99062; -.
PRIDE; Q99062; -.
ProteomicsDB; 78226; -.
ProteomicsDB; 78227; -. [Q99062-2]
ProteomicsDB; 78228; -. [Q99062-3]
ProteomicsDB; 78229; -. [Q99062-4]
Ensembl; ENST00000331941; ENSP00000332180; ENSG00000119535. [Q99062-4]
Ensembl; ENST00000361632; ENSP00000355406; ENSG00000119535. [Q99062-1]
Ensembl; ENST00000373103; ENSP00000362195; ENSG00000119535. [Q99062-3]
Ensembl; ENST00000373104; ENSP00000362196; ENSG00000119535. [Q99062-4]
Ensembl; ENST00000373106; ENSP00000362198; ENSG00000119535. [Q99062-1]
GeneID; 1441; -.
KEGG; hsa:1441; -.
UCSC; uc001cav.3; human. [Q99062-1]
CTD; 1441; -.
DisGeNET; 1441; -.
EuPathDB; HostDB:ENSG00000119535.17; -.
GeneCards; CSF3R; -.
HGNC; HGNC:2439; CSF3R.
HPA; CAB017116; -.
HPA; HPA048086; -.
MalaCards; CSF3R; -.
MIM; 138971; gene.
MIM; 162830; phenotype.
MIM; 617014; phenotype.
neXtProt; NX_Q99062; -.
OpenTargets; ENSG00000119535; -.
Orphanet; 98824; Atypical chronic myeloid leukemia.
Orphanet; 86829; Chronic neutrophilic leukemia.
Orphanet; 279943; Hereditary neutrophilia.
PharmGKB; PA26942; -.
eggNOG; ENOG410IGHT; Eukaryota.
eggNOG; ENOG410XVIU; LUCA.
GeneTree; ENSGT00550000074436; -.
HOGENOM; HOG000231142; -.
HOVERGEN; HBG051130; -.
InParanoid; Q99062; -.
KO; K05061; -.
OMA; YLRCDST; -.
OrthoDB; EOG091G01XM; -.
PhylomeDB; Q99062; -.
TreeFam; TF338122; -.
Reactome; R-HSA-449836; Other interleukin signaling.
SignaLink; Q99062; -.
SIGNOR; Q99062; -.
ChiTaRS; CSF3R; human.
EvolutionaryTrace; Q99062; -.
GeneWiki; Granulocyte_colony-stimulating_factor_receptor; -.
GenomeRNAi; 1441; -.
PRO; PR:Q99062; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000119535; Expressed in 145 organ(s), highest expression level in blood.
CleanEx; HS_CSF3R; -.
ExpressionAtlas; Q99062; baseline and differential.
Genevisible; Q99062; HS.
GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
GO; GO:0005887; C:integral component of plasma membrane; TAS:ProtInc.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0004896; F:cytokine receptor activity; IEA:InterPro.
GO; GO:0051916; F:granulocyte colony-stimulating factor binding; IEA:Ensembl.
GO; GO:0038023; F:signaling receptor activity; TAS:ProtInc.
GO; GO:0097186; P:amelogenesis; IEA:Ensembl.
GO; GO:0007155; P:cell adhesion; IEA:UniProtKB-KW.
GO; GO:0019221; P:cytokine-mediated signaling pathway; TAS:Reactome.
GO; GO:0006952; P:defense response; TAS:ProtInc.
GO; GO:0030593; P:neutrophil chemotaxis; IEA:Ensembl.
GO; GO:0045637; P:regulation of myeloid cell differentiation; IEA:Ensembl.
GO; GO:0007165; P:signal transduction; NAS:ProtInc.
CDD; cd00063; FN3; 4.
Gene3D; 2.60.40.10; -; 6.
InterPro; IPR003961; FN3_dom.
InterPro; IPR036116; FN3_sf.
InterPro; IPR003529; Hematopoietin_rcpt_Gp130_CS.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR010457; IgC2-like_lig-bd.
Pfam; PF00041; fn3; 1.
Pfam; PF06328; Lep_receptor_Ig; 1.
SMART; SM00060; FN3; 5.
SUPFAM; SSF48726; SSF48726; 1.
SUPFAM; SSF49265; SSF49265; 4.
PROSITE; PS50853; FN3; 5.
PROSITE; PS01353; HEMATOPO_REC_L_F2; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Cell adhesion; Cell membrane;
Complete proteome; Direct protein sequencing; Disease mutation;
Disulfide bond; Glycoprotein; Immunoglobulin domain; Membrane;
Polymorphism; Receptor; Reference proteome; Repeat; Secreted; Signal;
Transmembrane; Transmembrane helix.
SIGNAL 1 24
CHAIN 25 836 Granulocyte colony-stimulating factor
receptor.
/FTId=PRO_0000010874.
TOPO_DOM 25 627 Extracellular. {ECO:0000255}.
TRANSMEM 628 650 Helical. {ECO:0000255}.
TOPO_DOM 651 836 Cytoplasmic. {ECO:0000255}.
DOMAIN 25 117 Ig-like C2-type.
DOMAIN 125 230 Fibronectin type-III 1.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 233 332 Fibronectin type-III 2.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 334 430 Fibronectin type-III 3.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 431 528 Fibronectin type-III 4.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 530 623 Fibronectin type-III 5.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
MOTIF 318 322 WSXWS motif.
MOTIF 658 666 Box 1 motif.
CARBOHYD 51 51 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 93 93 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 128 128 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 134 134 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:16492764}.
CARBOHYD 389 389 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 474 474 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 579 579 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 610 610 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 26 52 {ECO:0000269|PubMed:16492764}.
DISULFID 46 101 {ECO:0000269|PubMed:16492764}.
DISULFID 131 142 {ECO:0000269|PubMed:16492764}.
DISULFID 167 218 {ECO:0000269|PubMed:16492764}.
DISULFID 177 186 {ECO:0000269|PubMed:16492764}.
DISULFID 248 295 {ECO:0000269|PubMed:16492764}.
DISULFID 266 309 {ECO:0000269|PubMed:16492764}.
VAR_SEQ 622 836 EGSELHIILGLFGLLLLLTCLCGTAWLCCSPNRKNPLWPSV
PDPAHSSLGSWVPTIMEEDAFQLPGLGTPPITKLTVLEEDE
KKPVPWESHNSSETCGLPTLVQTYVLQGDPRAVSTQPQSQS
GTSDQVLYGQLLGSPTSPGPGHYLRCDSTQPLLAGLTPSPK
SYENLWFQASPLGTLVTPAPSQEDDCVFGPLLNFPLLQGIR
VHGMEALGSF -> APTGRIPSGQVSQTQLTAAWAPGCPQS
WRRMPSSCPALARHPSPSSQCWRRMKRSRCPGSPITAQRPV
ASPLWSRPMCSRGTQEQFPPSPNPSLAPAIRSFMGSCWAAP
QAQGQGTISAVTPLSPSWRASPPAPSPMRTSGSRPAPWGPW
(in isoform 2).
{ECO:0000303|PubMed:1701053}.
/FTId=VSP_001674.
VAR_SEQ 680 680 E -> ELPGPRQGQWLGQTSEMSRALTPHPCVQ (in
isoform 3). {ECO:0000303|PubMed:1701053}.
/FTId=VSP_001673.
VAR_SEQ 750 783 VLYGQLLGSPTSPGPGHYLRCDSTQPLLAGLTPS -> AGP
PRRSAYFKDQIMLHPAPPNGLLCLFPITSVL (in
isoform 4). {ECO:0000303|PubMed:2147944}.
/FTId=VSP_001671.
VAR_SEQ 784 836 Missing (in isoform 4).
{ECO:0000303|PubMed:2147944}.
/FTId=VSP_001672.
VARIANT 229 229 P -> H (probable disease-associated
mutation found in a patient with
apparently autosomal dominant severe
congenital neutropenia; affects CSF3
mediated proliferation and survival of
myeloid cells; abrogates receptor
signaling by altering ligand binding;
dominant negative effect;
dbSNP:rs764202764).
{ECO:0000269|PubMed:10449521}.
/FTId=VAR_062517.
VARIANT 231 231 M -> T (in dbSNP:rs3917973).
{ECO:0000269|Ref.4}.
/FTId=VAR_014325.
VARIANT 308 308 R -> C (in SCN7; decreases localization
to plasma membrane; decreases receptor
signaling; dbSNP:rs606231473).
{ECO:0000269|PubMed:24753537}.
/FTId=VAR_077011.
VARIANT 320 320 D -> N (in dbSNP:rs3918018).
{ECO:0000269|Ref.4}.
/FTId=VAR_014326.
VARIANT 346 346 Q -> R (in dbSNP:rs3917974).
{ECO:0000269|Ref.4}.
/FTId=VAR_014327.
VARIANT 405 405 E -> K (in dbSNP:rs3918019).
{ECO:0000269|Ref.4}.
/FTId=VAR_014328.
VARIANT 440 440 R -> Q (in dbSNP:rs3918020).
{ECO:0000269|Ref.4}.
/FTId=VAR_014329.
VARIANT 510 510 D -> H (in dbSNP:rs3917991).
{ECO:0000269|Ref.4}.
/FTId=VAR_014330.
VARIANT 562 562 Y -> H (in dbSNP:rs3917996).
{ECO:0000269|Ref.4}.
/FTId=VAR_014331.
VARIANT 583 583 R -> C (in dbSNP:rs3917997).
{ECO:0000269|Ref.4}.
/FTId=VAR_014332.
VARIANT 640 640 T -> N (in neutrophilia;
dbSNP:rs121918426).
{ECO:0000269|PubMed:19620628}.
/FTId=VAR_063065.
STRAND 29 32 {ECO:0000244|PDB:2D9Q}.
STRAND 34 36 {ECO:0000244|PDB:2D9Q}.
STRAND 42 46 {ECO:0000244|PDB:2D9Q}.
STRAND 62 67 {ECO:0000244|PDB:2D9Q}.
STRAND 79 81 {ECO:0000244|PDB:2D9Q}.
STRAND 85 90 {ECO:0000244|PDB:2D9Q}.
STRAND 94 119 {ECO:0000244|PDB:2D9Q}.
STRAND 127 134 {ECO:0000244|PDB:2D9Q}.
TURN 135 138 {ECO:0000244|PDB:2D9Q}.
STRAND 139 145 {ECO:0000244|PDB:2D9Q}.
STRAND 155 162 {ECO:0000244|PDB:2D9Q}.
STRAND 174 177 {ECO:0000244|PDB:2D9Q}.
STRAND 184 189 {ECO:0000244|PDB:2D9Q}.
HELIX 190 192 {ECO:0000244|PDB:2D9Q}.
STRAND 195 197 {ECO:0000244|PDB:2D9Q}.
STRAND 199 207 {ECO:0000244|PDB:2D9Q}.
STRAND 210 213 {ECO:0000244|PDB:2D9Q}.
STRAND 217 219 {ECO:0000244|PDB:2D9Q}.
HELIX 221 224 {ECO:0000244|PDB:2D9Q}.
STRAND 231 234 {ECO:0000244|PDB:2D9Q}.
STRAND 249 254 {ECO:0000244|PDB:2D9Q}.
HELIX 257 259 {ECO:0000244|PDB:2D9Q}.
STRAND 264 275 {ECO:0000244|PDB:2D9Q}.
STRAND 280 285 {ECO:0000244|PDB:2D9Q}.
STRAND 289 294 {ECO:0000244|PDB:2D9Q}.
STRAND 303 311 {ECO:0000244|PDB:2D9Q}.
STRAND 325 327 {ECO:0000244|PDB:2D9Q}.
SEQUENCE 836 AA; 92156 MW; 3531ADDC979D4BC3 CRC64;
MARLGNCSLT WAALIILLLP GSLEECGHIS VSAPIVHLGD PITASCIIKQ NCSHLDPEPQ
ILWRLGAELQ PGGRQQRLSD GTQESIITLP HLNHTQAFLS CCLNWGNSLQ ILDQVELRAG
YPPAIPHNLS CLMNLTTSSL ICQWEPGPET HLPTSFTLKS FKSRGNCQTQ GDSILDCVPK
DGQSHCCIPR KHLLLYQNMG IWVQAENALG TSMSPQLCLD PMDVVKLEPP MLRTMDPSPE
AAPPQAGCLQ LCWEPWQPGL HINQKCELRH KPQRGEASWA LVGPLPLEAL QYELCGLLPA
TAYTLQIRCI RWPLPGHWSD WSPSLELRTT ERAPTVRLDT WWRQRQLDPR TVQLFWKPVP
LEEDSGRIQG YVVSWRPSGQ AGAILPLCNT TELSCTFHLP SEAQEVALVA YNSAGTSRPT
PVVFSESRGP ALTRLHAMAR DPHSLWVGWE PPNPWPQGYV IEWGLGPPSA SNSNKTWRME
QNGRATGFLL KENIRPFQLY EIIVTPLYQD TMGPSQHVYA YSQEMAPSHA PELHLKHIGK
TWAQLEWVPE PPELGKSPLT HYTIFWTNAQ NQSFSAILNA SSRGFVLHGL EPASLYHIHL
MAASQAGATN STVLTLMTLT PEGSELHIIL GLFGLLLLLT CLCGTAWLCC SPNRKNPLWP
SVPDPAHSSL GSWVPTIMEE DAFQLPGLGT PPITKLTVLE EDEKKPVPWE SHNSSETCGL
PTLVQTYVLQ GDPRAVSTQP QSQSGTSDQV LYGQLLGSPT SPGPGHYLRC DSTQPLLAGL
TPSPKSYENL WFQASPLGTL VTPAPSQEDD CVFGPLLNFP LLQGIRVHGM EALGSF


Related products :

Catalog number Product name Quantity
ELH-GCSFR-001 Custom Human Granulocye Colony Stimulating Factor Receptor (G-CSF R) _ CD114 ELISA Kit available on demand 1 X 96 well strip plate
E2217m Csf3r,Csfgr,G-CSF receptor,G-CSF-R,Granulocyte colony-stimulating factor receptor,Mouse,Mus musculus
U2217m CLIA kit Csf3r,Csfgr,G-CSF receptor,G-CSF-R,Granulocyte colony-stimulating factor receptor,Mouse,Mus musculus 96T
E2217m ELISA Csf3r,Csfgr,G-CSF receptor,G-CSF-R,Granulocyte colony-stimulating factor receptor,Mouse,Mus musculus 96T
E2217h CSF3R,G-CSF receptor,GCSFR,G-CSF-R,Granulocyte colony-stimulating factor receptor,Homo sapiens,Human
U2217m CLIA Csf3r,Csfgr,G-CSF receptor,G-CSF-R,Granulocyte colony-stimulating factor receptor,Mouse,Mus musculus 96T
E2217m ELISA kit Csf3r,Csfgr,G-CSF receptor,G-CSF-R,Granulocyte colony-stimulating factor receptor,Mouse,Mus musculus 96T
U2217h CLIA CSF3R,G-CSF receptor,GCSFR,G-CSF-R,Granulocyte colony-stimulating factor receptor,Homo sapiens,Human 96T
U2217h CLIA kit CSF3R,G-CSF receptor,GCSFR,G-CSF-R,Granulocyte colony-stimulating factor receptor,Homo sapiens,Human 96T
E2217h ELISA CSF3R,G-CSF receptor,GCSFR,G-CSF-R,Granulocyte colony-stimulating factor receptor,Homo sapiens,Human 96T
E2217h ELISA kit CSF3R,G-CSF receptor,GCSFR,G-CSF-R,Granulocyte colony-stimulating factor receptor,Homo sapiens,Human 96T
U2217r Rat Granulocyte Colony Stimulating Factor receptor 96T
E2217r Rat Granulocyte Colony Stimulating Factor receptor 96T
E02G0115 Rat Granulocyte Colony Stimulating Factor Receptor ELISA 96T/kit
EH3124 Colony Stimulating Factor Receptor, Granulocyte Elisa Kit 96T
ER983 Colony Stimulating Factor Receptor, Granulocyte Elisa Kit 96T
E03G0115 Mouse Granulocyte Colony Stimulating Factor Receptor ELISA 96T/kit
E-EL-R0245 Rat GCSFR (Colony Stimulating Factor Receptor, Granulocyte) ELISA Kit 96T
201-11-0980 Rat Granulocyte Colony Stimulating Factor Receptor,G-CSFR ELISA Kit 96T
201-11-0980 Rat Granulocyte Colony Stimulating Factor Receptor(G-CSFR)ELISA Kit 96T
E12G0115 Chicken Granulocyte Colony Stimulating Factor Receptor ELISA 96T/kit
E06G0115 Goat Granulocyte Colony Stimulating Factor Receptor ELISA 96T/kit
CSGALNACT2 CSF3R Gene colony stimulating factor 3 receptor (granulocyte)
E08G0115 Canine Granulocyte Colony Stimulating Factor Receptor ELISA 96T/kit
E14G0115 Sheep Granulocyte Colony Stimulating Factor Receptor ELISA 96T/kit


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur