Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas (Adenylate cyclase-stimulating G alpha protein) (Extra large alphas protein) (XLalphas)

 GNAS1_MOUSE             Reviewed;        1133 AA.
Q6R0H7; A2A607; A2A608; Q6R0H4; Q6R0H5; Q6R2J5; Q9JJX0; Q9Z1N8;
17-OCT-2006, integrated into UniProtKB/Swiss-Prot.
05-JUL-2004, sequence version 1.
12-SEP-2018, entry version 128.
RecName: Full=Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas;
AltName: Full=Adenylate cyclase-stimulating G alpha protein;
AltName: Full=Extra large alphas protein;
Short=XLalphas;
Name=Gnas {ECO:0000312|MGI:MGI:95777};
Synonyms=Gnas1 {ECO:0000312|MGI:MGI:95777};
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1] {ECO:0000305, ECO:0000312|EMBL:AAS00601.1}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS XLAS-1; XLAS-2 AND XLAS-3), AND
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 935-1018 (ISOFORM XLAS-1).
STRAIN=129/Sv {ECO:0000312|EMBL:AAR99381.1},
BALB/cJ {ECO:0000312|EMBL:AAR99382.1},
C57BL/6J {ECO:0000312|EMBL:AAR99383.1}, and
FVB/N {ECO:0000312|EMBL:AAS00601.1};
TISSUE=Brain {ECO:0000312|EMBL:AAS00601.1};
PubMed=15148396; DOI=10.1073/pnas.0308758101;
Abramowitz J., Grenet D., Birnbaumer M., Torres H.N., Birnbaumer L.;
"XL alpha-s, the extra-long form of the alpha subunit of the Gs G
protein, is significantly longer than suspected, and so is its
companion Alex.";
Proc. Natl. Acad. Sci. U.S.A. 101:8366-8371(2004).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=C57BL/6J;
PubMed=19468303; DOI=10.1371/journal.pbio.1000112;
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S.,
She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W.,
Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T.,
Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J.,
Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z.,
Lindblad-Toh K., Eichler E.E., Ponting C.P.;
"Lineage-specific biology revealed by a finished genome assembly of
the mouse.";
PLoS Biol. 7:E1000112-E1000112(2009).
[3] {ECO:0000305, ECO:0000312|EMBL:CAB83219.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-785.
PubMed=10749992; DOI=10.1093/hmg/9.5.835;
Hayward B.E., Bonthron D.T.;
"An imprinted antisense transcript at the human GNAS1 locus.";
Hum. Mol. Genet. 9:835-841(2000).
[4] {ECO:0000305, ECO:0000312|EMBL:AAD14686.1}
NUCLEOTIDE SEQUENCE [MRNA] OF 357-1133 (ISOFORM XLAS-4).
STRAIN=C57BL/6J {ECO:0000312|EMBL:AAD14686.1};
PubMed=10931851; DOI=10.1074/jbc.M006594200;
Klemke M., Pasolli H.A., Kehlenbach R.H., Offermanns S., Schultz G.,
Huttner W.B.;
"Characterization of the extra-large G protein alpha-subunit XLalphas.
II. Signal transduction properties.";
J. Biol. Chem. 275:33633-33640(2000).
[5] {ECO:0000305}
FUNCTION, AND DISRUPTION PHENOTYPE.
PubMed=12145344; DOI=10.1210/me.2002-0054;
Bastepe M., Gunes Y., Perez-Villamil B., Hunzelman J., Weinstein L.S.,
Jueppner H.;
"Receptor-mediated adenylyl cyclase activation through XLalpha(s), the
extra-large variant of the stimulatory G protein alpha-subunit.";
Mol. Endocrinol. 16:1912-1919(2002).
[6]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung,
Pancreas, Spleen, and Testis;
PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
"A tissue-specific atlas of mouse protein phosphorylation and
expression.";
Cell 143:1174-1189(2010).
-!- FUNCTION: Guanine nucleotide-binding proteins (G proteins)
function as transducers in numerous signaling pathways controlled
by G protein-coupled receptors (GPCRs). Signaling involves the
activation of adenylyl cyclases, resulting in increased levels of
the signaling molecule cAMP. GNAS functions downstream of several
GPCRs, including beta-adrenergic receptors. XLas isoforms interact
with the same set of receptors as Gnas isoforms.
{ECO:0000269|PubMed:12145344}.
-!- SUBUNIT: G proteins are composed of 3 units; alpha, beta and
gamma. The alpha chain contains the guanine nucleotide binding
site. Interacts through its N-terminal region with ALEX which is
produced from the same locus in a different open reading frame.
This interaction may inhibit its adenylyl cyclase-stimulating
activity (By similarity). Interacts with MAGED2.
{ECO:0000250|UniProtKB:Q5JWF2, ECO:0000250|UniProtKB:Q63803}.
-!- SUBCELLULAR LOCATION: Cell membrane
{ECO:0000250|UniProtKB:Q63803}; Peripheral membrane protein
{ECO:0000250|UniProtKB:Q63803}. Apical cell membrane
{ECO:0000250|UniProtKB:Q5JWF2}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=9;
Name=XLas-1; Synonyms=XXL {ECO:0000269|PubMed:15148396};
IsoId=Q6R0H7-1; Sequence=Displayed;
Name=XLas-2; Synonyms=XXLb1 {ECO:0000269|PubMed:15148396};
IsoId=Q6R0H7-2; Sequence=VSP_052176, VSP_052180;
Name=XLas-3; Synonyms=XXLb2 {ECO:0000269|PubMed:15148396};
IsoId=Q6R0H7-3; Sequence=VSP_052177, VSP_052179;
Name=XLas-4;
IsoId=Q6R0H7-4; Sequence=VSP_052178;
Name=Gnas-1 {ECO:0000305};
IsoId=P63094-1; Sequence=External;
Name=Gnas-2 {ECO:0000305};
IsoId=P63094-2; Sequence=External;
Name=Gnas-3 {ECO:0000305}; Synonyms=NTas {ECO:0000305};
IsoId=P63094-3; Sequence=External;
Name=Nesp55-1 {ECO:0000305};
IsoId=Q9Z0F1-1; Sequence=External;
Note=Shares no sequence similarity with other isoforms (except
isoform Nesp55-2) due to a novel first exon containing the
entire reading frame spliced to shared exon 2 so that exons 2-13
make up the 3'-UTR.;
Name=Nesp55-2 {ECO:0000305};
IsoId=Q9Z0F1-2; Sequence=External;
Note=Shares no sequence similarity with other isoforms (except
isoform Nesp55-1) due to a novel first exon containing the
entire reading frame spliced to shared exon 2 so that exons 2-13
make up the 3'-UTR.;
-!- DISRUPTION PHENOTYPE: Mice cells lacking XLas isoforms which are
then transfected with these isoforms and a range of receptors
demonstrate that the XLas isoforms are capable of functionally
coupling to the same receptors as the Gnas isoforms including
Adrb2, Crfr1, Pthr1 and Tshr. {ECO:0000269|PubMed:12145344}.
-!- MISCELLANEOUS: This protein is produced by a bicistronic gene
which also produces the ALEX protein from an overlapping reading
frame. {ECO:0000250|UniProtKB:Q63803}.
-!- MISCELLANEOUS: The GNAS locus is imprinted in a complex manner,
giving rise to distinct paternally, maternally and biallelically
expressed proteins. The XLas isoforms are paternally derived, the
Gnas isoforms are biallelically derived and the Nesp55 isoforms
are maternally derived.
-!- SIMILARITY: Belongs to the G-alpha family. G(s) subfamily.
{ECO:0000255}.
-!- SEQUENCE CAUTION:
Sequence=AAD14686.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Sequence=CAB83219.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AY518305; AAR99380.1; -; Genomic_DNA.
EMBL; AY518306; AAR99381.1; -; Genomic_DNA.
EMBL; AY518307; AAR99382.1; -; Genomic_DNA.
EMBL; AY518308; AAR99383.1; -; Genomic_DNA.
EMBL; AY519501; AAS00601.1; -; mRNA.
EMBL; AY519503; AAS00603.1; -; mRNA.
EMBL; AY519504; AAS00604.1; -; mRNA.
EMBL; AL593857; CAM24406.1; -; Genomic_DNA.
EMBL; AL593857; CAM24407.1; -; Genomic_DNA.
EMBL; AJ251761; CAB83219.1; ALT_INIT; Genomic_DNA.
EMBL; AF116268; AAD14686.1; ALT_INIT; mRNA.
CCDS; CCDS17151.1; -. [Q6R0H7-1]
CCDS; CCDS38354.1; -. [Q6R0H7-4]
CCDS; CCDS38355.1; -. [Q6R0H7-2]
RefSeq; NP_001070975.1; NM_001077507.2. [Q6R0H7-4]
RefSeq; NP_001297014.1; NM_001310085.1. [Q6R0H7-3]
RefSeq; NP_034439.2; NM_010309.4. [Q6R0H7-1]
RefSeq; NP_963911.1; NM_201617.2. [Q6R0H7-2]
UniGene; Mm.125770; -.
UniGene; Mm.394046; -.
ProteinModelPortal; Q6R0H7; -.
SMR; Q6R0H7; -.
BioGrid; 199972; 6.
IntAct; Q6R0H7; 1.
STRING; 10090.ENSMUSP00000079341; -.
iPTMnet; Q6R0H7; -.
SwissPalm; Q6R0H7; -.
EPD; Q6R0H7; -.
PaxDb; Q6R0H7; -.
PeptideAtlas; Q6R0H7; -.
PRIDE; Q6R0H7; -.
Ensembl; ENSMUST00000080493; ENSMUSP00000079341; ENSMUSG00000027523. [Q6R0H7-1]
Ensembl; ENSMUST00000087876; ENSMUSP00000085184; ENSMUSG00000027523. [Q6R0H7-4]
Ensembl; ENSMUST00000087877; ENSMUSP00000085185; ENSMUSG00000027523. [Q6R0H7-2]
Ensembl; ENSMUST00000185956; ENSMUSP00000140174; ENSMUSG00000027523. [Q6R0H7-1]
GeneID; 14683; -.
UCSC; uc008oet.1; mouse. [Q6R0H7-2]
UCSC; uc033hrq.1; mouse. [Q6R0H7-4]
CTD; 2778; -.
MGI; MGI:95777; Gnas.
eggNOG; KOG0099; Eukaryota.
eggNOG; ENOG410XPC4; LUCA.
GeneTree; ENSGT00910000144108; -.
HOVERGEN; HBG079975; -.
InParanoid; Q6R0H7; -.
OMA; NEPPLWV; -.
OrthoDB; EOG091G0CAY; -.
PhylomeDB; Q6R0H7; -.
TreeFam; TF300673; -.
Reactome; R-MMU-163359; Glucagon signaling in metabolic regulation.
Reactome; R-MMU-164378; PKA activation in glucagon signalling.
Reactome; R-MMU-381676; Glucagon-like Peptide-1 (GLP1) regulates insulin secretion.
Reactome; R-MMU-392851; Prostacyclin signalling through prostacyclin receptor.
Reactome; R-MMU-418555; G alpha (s) signalling events.
Reactome; R-MMU-420092; Glucagon-type ligand receptors.
Reactome; R-MMU-432040; Vasopressin regulates renal water homeostasis via Aquaporins.
Reactome; R-MMU-5610787; Hedgehog 'off' state.
ChiTaRS; Gnas; mouse.
Proteomes; UP000000589; Chromosome 2.
Bgee; ENSMUSG00000027523; Expressed in 324 organ(s), highest expression level in brain.
ExpressionAtlas; Q6R0H7; baseline and differential.
Genevisible; Q6R0H7; MM.
GO; GO:0016324; C:apical plasma membrane; IEA:UniProtKB-SubCell.
GO; GO:0005737; C:cytoplasm; ISO:MGI.
GO; GO:0005829; C:cytosol; ISO:MGI.
GO; GO:0030425; C:dendrite; IDA:MGI.
GO; GO:0005768; C:endosome; ISO:MGI.
GO; GO:0005834; C:heterotrimeric G-protein complex; ISO:MGI.
GO; GO:0031224; C:intrinsic component of membrane; ISO:MGI.
GO; GO:0016020; C:membrane; IDA:MGI.
GO; GO:0045121; C:membrane raft; ISO:MGI.
GO; GO:0043025; C:neuronal cell body; ISO:MGI.
GO; GO:0005634; C:nucleus; ISO:MGI.
GO; GO:0048471; C:perinuclear region of cytoplasm; ISO:MGI.
GO; GO:0005886; C:plasma membrane; ISO:MGI.
GO; GO:0055037; C:recycling endosome; ISO:MGI.
GO; GO:0001726; C:ruffle; ISO:MGI.
GO; GO:0032588; C:trans-Golgi network membrane; ISO:MGI.
GO; GO:0047391; F:alkylglycerophosphoethanolamine phosphodiesterase activity; ISO:MGI.
GO; GO:0043014; F:alpha-tubulin binding; ISO:MGI.
GO; GO:0031698; F:beta-2 adrenergic receptor binding; ISO:MGI.
GO; GO:0051430; F:corticotropin-releasing hormone receptor 1 binding; ISO:MGI.
GO; GO:0031748; F:D1 dopamine receptor binding; ISO:MGI.
GO; GO:0001965; F:G-protein alpha-subunit binding; ISO:MGI.
GO; GO:0031681; F:G-protein beta-subunit binding; ISO:MGI.
GO; GO:0031683; F:G-protein beta/gamma-subunit complex binding; IBA:GO_Central.
GO; GO:0005525; F:GTP binding; ISO:MGI.
GO; GO:0003924; F:GTPase activity; ISO:MGI.
GO; GO:0005159; F:insulin-like growth factor receptor binding; ISO:MGI.
GO; GO:0035255; F:ionotropic glutamate receptor binding; ISO:MGI.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0031852; F:mu-type opioid receptor binding; ISO:MGI.
GO; GO:0019904; F:protein domain specific binding; ISO:MGI.
GO; GO:0071880; P:adenylate cyclase-activating adrenergic receptor signaling pathway; ISO:MGI.
GO; GO:0007191; P:adenylate cyclase-activating dopamine receptor signaling pathway; IGI:MGI.
GO; GO:0007189; P:adenylate cyclase-activating G-protein coupled receptor signaling pathway; IDA:MGI.
GO; GO:0060348; P:bone development; ISO:MGI.
GO; GO:0055074; P:calcium ion homeostasis; ISO:MGI.
GO; GO:0051216; P:cartilage development; IMP:MGI.
GO; GO:0071870; P:cellular response to catecholamine stimulus; ISO:MGI.
GO; GO:0071380; P:cellular response to prostaglandin E stimulus; ISO:MGI.
GO; GO:0050890; P:cognition; ISO:MGI.
GO; GO:0048589; P:developmental growth; ISO:MGI.
GO; GO:0006306; P:DNA methylation; IMP:MGI.
GO; GO:0048701; P:embryonic cranial skeleton morphogenesis; IMP:MGI.
GO; GO:0035116; P:embryonic hindlimb morphogenesis; IMP:MGI.
GO; GO:0001958; P:endochondral ossification; IMP:MGI.
GO; GO:0006112; P:energy reserve metabolic process; IMP:MGI.
GO; GO:0007186; P:G-protein coupled receptor signaling pathway; ISO:MGI.
GO; GO:0071514; P:genetic imprinting; IMP:MGI.
GO; GO:0060789; P:hair follicle placode formation; ISO:MGI.
GO; GO:0035264; P:multicellular organism growth; IMP:MGI.
GO; GO:0045776; P:negative regulation of blood pressure; ISO:MGI.
GO; GO:0035814; P:negative regulation of renal sodium excretion; ISO:MGI.
GO; GO:0070527; P:platelet aggregation; ISO:MGI.
GO; GO:0043950; P:positive regulation of cAMP-mediated signaling; ISO:MGI.
GO; GO:0008284; P:positive regulation of cell proliferation; ISO:MGI.
GO; GO:0120162; P:positive regulation of cold-induced thermogenesis; IMP:YuBioLab.
GO; GO:0043547; P:positive regulation of GTPase activity; ISO:MGI.
GO; GO:0045669; P:positive regulation of osteoblast differentiation; IMP:MGI.
GO; GO:0045672; P:positive regulation of osteoclast differentiation; IMP:MGI.
GO; GO:0001934; P:positive regulation of protein phosphorylation; ISO:MGI.
GO; GO:0010765; P:positive regulation of sodium ion transport; ISO:MGI.
GO; GO:0040032; P:post-embryonic body morphogenesis; IMP:MGI.
GO; GO:0009791; P:post-embryonic development; IMP:MGI.
GO; GO:2000828; P:regulation of parathyroid hormone secretion; IMP:MGI.
GO; GO:0009966; P:regulation of signal transduction; ISO:MGI.
GO; GO:0006357; P:regulation of transcription by RNA polymerase II; ISO:MGI.
GO; GO:0042493; P:response to drug; IMP:MGI.
GO; GO:0071107; P:response to parathyroid hormone; ISO:MGI.
GO; GO:0007606; P:sensory perception of chemical stimulus; IBA:GO_Central.
GO; GO:0001501; P:skeletal system development; IMP:MGI.
GO; GO:0043588; P:skin development; IMP:MGI.
GO; GO:0001894; P:tissue homeostasis; IMP:MGI.
CDD; cd00066; G-alpha; 1.
Gene3D; 1.10.400.10; -; 1.
InterPro; IPR000367; Gprotein_alpha_S.
InterPro; IPR001019; Gprotein_alpha_su.
InterPro; IPR011025; GproteinA_insert.
InterPro; IPR027417; P-loop_NTPase.
PANTHER; PTHR10218; PTHR10218; 1.
Pfam; PF00503; G-alpha; 1.
PRINTS; PR00318; GPROTEINA.
PRINTS; PR00443; GPROTEINAS.
SMART; SM00275; G_alpha; 1.
SUPFAM; SSF47895; SSF47895; 1.
SUPFAM; SSF52540; SSF52540; 2.
1: Evidence at protein level;
ADP-ribosylation; Alternative splicing; Cell membrane; Coiled coil;
Complete proteome; GTP-binding; Magnesium; Membrane; Metal-binding;
Nucleotide-binding; Phosphoprotein; Reference proteome; Transducer.
CHAIN 1 1133 Guanine nucleotide-binding protein G(s)
subunit alpha isoforms XLas.
/FTId=PRO_0000253985.
NP_BIND 786 794 GTP. {ECO:0000250|UniProtKB:P04896}.
NP_BIND 936 943 GTP. {ECO:0000250|UniProtKB:P04896}.
NP_BIND 962 966 GTP. {ECO:0000250|UniProtKB:P63096}.
NP_BIND 1031 1034 GTP. {ECO:0000250|UniProtKB:P63096}.
COILED 737 761 {ECO:0000255}.
COMPBIAS 19 303 Pro-rich. {ECO:0000255}.
COMPBIAS 450 619 Ala-rich. {ECO:0000255}.
METAL 793 793 Magnesium.
{ECO:0000250|UniProtKB:P04896}.
METAL 943 943 Magnesium.
{ECO:0000250|UniProtKB:P04896}.
BINDING 1105 1105 GTP; via amide nitrogen.
{ECO:0000250|UniProtKB:P04896}.
MOD_RES 940 940 ADP-ribosylarginine; by cholera toxin.
{ECO:0000250}.
MOD_RES 1091 1091 Phosphoserine.
{ECO:0000250|UniProtKB:Q5JWF2}.
VAR_SEQ 787 876 AGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEK
ATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVD
YILSVMNV -> RKVVPSDTEGRYRPEASASASDRRLDRRG
REVSPELLGWALRGSPGSIVRDRGGLGPSGCAPPPRLARLL
RLRQLVVGVCWCPFSVFACA (in isoform XLas-2).
{ECO:0000303|PubMed:15148396}.
/FTId=VSP_052176.
VAR_SEQ 787 827 AGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEK
-> RKVVPSDTEGRYRPEASASASDRRLDRRGREVLESLAK
APL (in isoform XLas-3).
{ECO:0000303|PubMed:15148396}.
/FTId=VSP_052177.
VAR_SEQ 810 825 EGGEEDPQAARSNSDG -> DS (in isoform XLas-
4). {ECO:0000303|PubMed:10931851}.
/FTId=VSP_052178.
VAR_SEQ 828 1133 Missing (in isoform XLas-3).
{ECO:0000303|PubMed:15148396}.
/FTId=VSP_052179.
VAR_SEQ 877 1133 Missing (in isoform XLas-2).
{ECO:0000303|PubMed:15148396}.
/FTId=VSP_052180.
CONFLICT 371 371 A -> G (in Ref. 4; CAB83219).
{ECO:0000305}.
CONFLICT 381 381 P -> S (in Ref. 4; CAB83219).
{ECO:0000305}.
CONFLICT 578 591 SLSATPAARASLPA -> YSRYSQLLPPLGHPFLPR (in
Ref. 3). {ECO:0000305}.
CONFLICT 595 596 Missing (in Ref. 3). {ECO:0000305}.
CONFLICT 599 599 A -> Q (in Ref. 3). {ECO:0000305}.
CONFLICT 613 617 SAAPS -> LPPH (in Ref. 3). {ECO:0000305}.
CONFLICT 622 628 RPPSPEI -> DPQPRD (in Ref. 3).
{ECO:0000305}.
SEQUENCE 1133 AA; 121505 MW; C1497D45498172F7 CRC64;
MGMFNCLHGN NMSGQHDIPP EVGEQPEQEP LEAPGAAAPG AGAGPAEEMA TEPDSEPSNN
EPVPDETGSE ISGPPEDSKS DIQSPCQAFE EVRVGGDYSP PPEEAMPFET QQPSLGDFWP
TLEQPGPSGT PSGLQAFNPA ILEPGTPTGA SPGLGAYTPP PEEAMPFEFN EPAQGDHSQP
PLQVPDLAPG GPEALVPRAL PAEPGNIRFE NAGFREDYSP PPEESVPFQV GGEEFGGDSP
PPGLPRVIPQ IGIGGEFPTV AVPSALCLAP AENAPPLWVR GAIDRPFREA VRSPPNFACD
SPPMEITRPL LEIGRASIGV DDDTAVNMDS PPIASDGPPI EVSGAPDKSE CAERPPVERE
AAEMEGSPTT ATAVEGKVPS PERGDGSSTQ PEAMDAKPAP AAQAVSTGSD AGAPTDSAML
TDSQSDAGED GTAPGTPSDL QSDPEELEEA PAVRADPDGG AAPVAPATPA ESESEGSRDP
AAEPASEAVP ATTAESASGA APVTQVEPAA AAVSATLAEP AARAAPITPK EPTTRAVPSA
RAHPAAGAVP GAPAMSASAR AAAARAAYAG PLVWGARSLS ATPAARASLP ARAAAAARAA
SAARAVAAGR SASAAPSRAH LRPPSPEIQV ADPPTPRPPP RPTAWPDKYE RGRSCCRYEA
SSGICEIESS SDESEEGATG CFQWLLRRNR RPGLPRSHTV GSNPVRNFFT RAFGSCFGLS
ECTRSRSLSP GKAKDPMEER RKQMRKEAIE MREQKRADKK RSKLIDKQLE EEKMDYMCTH
RLLLLGAGES GKSTIVKQMR ILHVNGFNGE GGEEDPQAAR SNSDGEKATK VQDIKNNLKE
AIETIVAAMS NLVPPVELAN PENQFRVDYI LSVMNVPNFD FPPEFYEHAK ALWEDEGVRA
CYERSNEYQL IDCAQYFLDK IDVIKQADYV PSDQDLLRCR VLTSGIFETK FQVDKVNFHM
FDVGGQRDER RKWIQCFNDV TAIIFVVASS SYNMVIREDN QTNRLQEALN LFKSIWNNRW
LRTISVILFL NKQDLLAEKV LAGKSKIEDY FPEFARYTTP EDATPEPGED PRVTRAKYFI
RDEFLRISTA SGDGRHYCYP HFTCAVDTEN IRRVFNDCRD IIQRMHLRQY ELL


Related products :

Catalog number Product name Quantity
E14979r Human ELISA Kit FOR Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas 96T
GNAS1_MOUSE ELISA Kit FOR Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas; organism: Mouse; gene name: Gnas 96T
GNAS2_RAT Rat ELISA Kit FOR Guanine nucleotide-binding protein G(s) subunit alpha isoforms short 96T
GNAS2_MOUSE ELISA Kit FOR Guanine nucleotide-binding protein G(s) subunit alpha isoforms short; organism: Mouse; gene name: Gnas 96T
15-288-22489 Guanine nucleotide-binding protein G(k) subunit alpha - G(i) alpha-3 Polyclonal 0.1 mg
15-288-22489 Guanine nucleotide-binding protein G(k) subunit alpha - G(i) alpha-3 Polyclonal 0.05 mg
GNA12_RAT Rat ELISA Kit FOR Guanine nucleotide-binding protein subunit alpha-12 96T
E1275m Rat ELISA Kit FOR Guanine nucleotide-binding protein G(i) subunit alpha-2 96T
GNAO_RAT Rat ELISA Kit FOR Guanine nucleotide-binding protein G(o) subunit alpha 96T
GNAQ_RAT Rat ELISA Kit FOR Guanine nucleotide-binding protein G(q) subunit alpha 96T
CSB-EL009583RA Rat Guanine nucleotide-binding protein subunit alpha-11(GNA11) ELISA kit 96T
GNAI1_BOVIN Bovine ELISA Kit FOR Guanine nucleotide-binding protein G(i) subunit alpha-1 96T
GNAT1_BOVIN Bovine ELISA Kit FOR Guanine nucleotide-binding protein G(t) subunit alpha-1 96T
CSB-EL009583DO Dog Guanine nucleotide-binding protein subunit alpha-11(GNA11) ELISA kit 96T
18-003-44268 Mutant guanine nucleotide-binding protein G(S). alpha subunit - N_A Polyclonal 0.1 mg Protein A
ZN274_HUMAN Mouse ELISA Kit FOR Guanine nucleotide-binding protein subunit alpha-12 96T
E0604h Bovine ELISA Kit FOR Guanine nucleotide-binding protein G(o) subunit alpha 96T
GNAI2_CHICK Chicken ELISA Kit FOR Guanine nucleotide-binding protein G(i) subunit alpha-2 96T
E0140p Mouse ELISA Kit FOR Guanine nucleotide-binding protein subunit alpha-12 96T
E10365m Human ELISA Kit FOR Guanine nucleotide-binding protein G(o) subunit alpha 96T
GNAI2_HUMAN Human ELISA Kit FOR Guanine nucleotide-binding protein G(i) subunit alpha-2 96T
E15054r Bovine ELISA Kit FOR Guanine nucleotide-binding protein subunit alpha-14 96T
GNA11_HUMAN Human ELISA Kit FOR Guanine nucleotide-binding protein subunit alpha-11 96T
DEN1A_HUMAN Mouse ELISA Kit FOR Guanine nucleotide-binding protein subunit alpha-12 96T
18-003-43749 Mutant guanine nucleotide-binding protein G(S). alpha subunit - N_A Polyclonal 0.1 mg Protein A


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur