Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

HBS1-like protein (ERFS)

 HBS1L_HUMAN             Reviewed;         684 AA.
Q9Y450; B7Z365; Q4VX89; Q4VX90; Q5T7G3; Q8NDW9; Q9UPW3;
10-MAY-2005, integrated into UniProtKB/Swiss-Prot.
01-NOV-1999, sequence version 1.
22-NOV-2017, entry version 154.
RecName: Full=HBS1-like protein;
AltName: Full=ERFS;
Name=HBS1L; Synonyms=HBS1, KIAA1038;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND TISSUE SPECIFICITY.
TISSUE=Pancreatic cancer;
PubMed=9872408; DOI=10.1016/S0014-5793(98)01492-6;
Wallrapp C., Verrier S.-B., Zhouravleva G., Philippe H., Philippe M.,
Gress T.M., Jean-Jean O.;
"The product of the mammalian orthologue of the Saccharomyces
cerevisiae HBS1 gene is phylogenetically related to eukaryotic release
factor 3 (eRF3) but does not carry eRF3-like activity.";
FEBS Lett. 440:387-392(1998).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
Close J.P., Game L.G., Clark B., Thein S.L.;
"An integrated physical and transcript map of human 6q23 encompassing
a quantitative trait loci for foetal haemaglobin expression.";
Thesis (2002), University of Oxford, United Kingdom.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
TISSUE=Hippocampus;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=14574404; DOI=10.1038/nature02055;
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L.,
Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E.,
Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R.,
Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S.,
Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J.,
Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P.,
Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y.,
Burford D.C., Burrill W., Burton J., Carder C., Carter N.P.,
Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V.,
Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J.,
Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E.,
Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A.,
Frankland J., French L., Garner P., Garnett J., Ghori M.J.,
Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M.,
Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S.,
Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R.,
Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E.,
Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A.,
Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C.,
Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M.,
Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M.,
Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K.,
McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T.,
Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R.,
Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W.,
Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M.,
Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L.,
Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J.,
Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B.,
Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L.,
Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W.,
Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A.,
Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.;
"The DNA sequence and analysis of human chromosome 6.";
Nature 425:805-811(2003).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Cervix, and Placenta;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 189-684 (ISOFORMS 1/3).
TISSUE=Brain;
PubMed=10470851; DOI=10.1093/dnares/6.3.197;
Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N.,
Tanaka A., Kotani H., Nomura N., Ohara O.;
"Prediction of the coding sequences of unidentified human genes. XIV.
The complete sequences of 100 new cDNA clones from brain which code
for large proteins in vitro.";
DNA Res. 6:197-205(1999).
[8]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[9]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-246 (ISOFORM 2), AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Leukemic T-cell;
PubMed=19690332; DOI=10.1126/scisignal.2000007;
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,
Rodionov V., Han D.K.;
"Quantitative phosphoproteomic analysis of T cell receptor signaling
reveals system-wide modulation of protein-protein interactions.";
Sci. Signal. 2:RA46-RA46(2009).
[10]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-117 AND SER-127, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=20068231; DOI=10.1126/scisignal.2000475;
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L.,
Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S.,
Mann M.;
"Quantitative phosphoproteomics reveals widespread full
phosphorylation site occupancy during mitosis.";
Sci. Signal. 3:RA3-RA3(2010).
[11]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[12]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21406692; DOI=10.1126/scisignal.2001570;
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J.,
Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V.,
Blagoev B.;
"System-wide temporal characterization of the proteome and
phosphoproteome of human embryonic stem cell differentiation.";
Sci. Signal. 4:RS3-RS3(2011).
[13]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-49; SER-67; SER-127;
SER-154 AND THR-231, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE
SCALE ANALYSIS].
TISSUE=Cervix carcinoma, and Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q9Y450-1; Sequence=Displayed;
Name=2;
IsoId=Q9Y450-2; Sequence=VSP_013624;
Note=Contains a phosphoserine at position 246.
{ECO:0000244|PubMed:19690332};
Name=3;
IsoId=Q9Y450-4; Sequence=VSP_041068;
-!- TISSUE SPECIFICITY: Detected in heart, brain, placenta, liver,
muscle, kidney and pancreas. {ECO:0000269|PubMed:9872408}.
-!- SIMILARITY: Belongs to the TRAFAC class translation factor GTPase
superfamily. Classic translation factor GTPase family.
{ECO:0000255|PROSITE-ProRule:PRU01059}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; U87791; AAD00645.1; -; mRNA.
EMBL; AJ459826; CAD30873.1; -; mRNA.
EMBL; AJ459827; CAD30874.1; -; mRNA.
EMBL; AK295545; BAH12101.1; -; mRNA.
EMBL; AL353596; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL445190; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471051; EAW47982.1; -; Genomic_DNA.
EMBL; BC001465; AAH01465.1; -; mRNA.
EMBL; BC040849; AAH40849.1; -; mRNA.
EMBL; AB028961; BAA82990.1; -; mRNA.
CCDS; CCDS47479.1; -. [Q9Y450-4]
CCDS; CCDS47480.1; -. [Q9Y450-2]
CCDS; CCDS5173.1; -. [Q9Y450-1]
RefSeq; NP_001138630.1; NM_001145158.1. [Q9Y450-4]
RefSeq; NP_001138679.1; NM_001145207.1. [Q9Y450-2]
RefSeq; NP_006611.1; NM_006620.3. [Q9Y450-1]
UniGene; Hs.378532; -.
PDB; 5LZW; EM; 3.53 A; jj=1-684.
PDB; 5LZX; EM; 3.67 A; jj=1-684.
PDB; 5LZY; EM; 3.99 A; jj=1-684.
PDB; 5LZZ; EM; 3.47 A; jj=1-684.
PDBsum; 5LZW; -.
PDBsum; 5LZX; -.
PDBsum; 5LZY; -.
PDBsum; 5LZZ; -.
ProteinModelPortal; Q9Y450; -.
SMR; Q9Y450; -.
BioGrid; 115986; 46.
IntAct; Q9Y450; 19.
MINT; MINT-6784072; -.
STRING; 9606.ENSP00000356811; -.
iPTMnet; Q9Y450; -.
PhosphoSitePlus; Q9Y450; -.
BioMuta; HBS1L; -.
DMDM; 68566500; -.
EPD; Q9Y450; -.
PaxDb; Q9Y450; -.
PeptideAtlas; Q9Y450; -.
PRIDE; Q9Y450; -.
DNASU; 10767; -.
Ensembl; ENST00000367822; ENSP00000356796; ENSG00000112339. [Q9Y450-2]
Ensembl; ENST00000367826; ENSP00000356800; ENSG00000112339. [Q9Y450-4]
Ensembl; ENST00000367837; ENSP00000356811; ENSG00000112339. [Q9Y450-1]
GeneID; 10767; -.
KEGG; hsa:10767; -.
UCSC; uc003qez.4; human. [Q9Y450-1]
CTD; 10767; -.
DisGeNET; 10767; -.
EuPathDB; HostDB:ENSG00000112339.14; -.
GeneCards; HBS1L; -.
HGNC; HGNC:4834; HBS1L.
HPA; HPA029728; -.
HPA; HPA029729; -.
MIM; 612450; gene.
neXtProt; NX_Q9Y450; -.
OpenTargets; ENSG00000112339; -.
PharmGKB; PA29209; -.
eggNOG; KOG0458; Eukaryota.
eggNOG; COG5256; LUCA.
GeneTree; ENSGT00620000087924; -.
HOVERGEN; HBG000179; -.
InParanoid; Q9Y450; -.
KO; K14416; -.
OMA; HMIVIGH; -.
OrthoDB; EOG091G0637; -.
PhylomeDB; Q9Y450; -.
TreeFam; TF105833; -.
Reactome; R-HSA-429958; mRNA decay by 3' to 5' exoribonuclease.
ChiTaRS; HBS1L; human.
GenomeRNAi; 10767; -.
PMAP-CutDB; Q9Y450; -.
PRO; PR:Q9Y450; -.
Proteomes; UP000005640; Chromosome 6.
Bgee; ENSG00000112339; -.
CleanEx; HS_HBS1L; -.
ExpressionAtlas; Q9Y450; baseline and differential.
Genevisible; Q9Y450; HS.
GO; GO:0005829; C:cytosol; TAS:Reactome.
GO; GO:0070062; C:extracellular exosome; IDA:UniProtKB.
GO; GO:0005622; C:intracellular; IBA:GO_Central.
GO; GO:0016020; C:membrane; IDA:UniProtKB.
GO; GO:0005525; F:GTP binding; TAS:ProtInc.
GO; GO:0003924; F:GTPase activity; IBA:GO_Central.
GO; GO:0003746; F:translation elongation factor activity; IEA:UniProtKB-KW.
GO; GO:0043928; P:exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay; TAS:Reactome.
GO; GO:0007165; P:signal transduction; TAS:ProtInc.
GO; GO:0006412; P:translation; TAS:ProtInc.
InterPro; IPR004161; EFTu-like_2.
InterPro; IPR015033; HBS1-like_N.
InterPro; IPR037189; HBS1-like_N_sf.
InterPro; IPR027417; P-loop_NTPase.
InterPro; IPR000795; TF_GTP-bd_dom.
InterPro; IPR009000; Transl_B-barrel_sf.
InterPro; IPR009001; Transl_elong_EF1A/Init_IF2_C.
InterPro; IPR004160; Transl_elong_EFTu/EF1A_C.
Pfam; PF00009; GTP_EFTU; 1.
Pfam; PF03144; GTP_EFTU_D2; 1.
Pfam; PF03143; GTP_EFTU_D3; 1.
Pfam; PF08938; HBS1_N; 1.
PRINTS; PR00315; ELONGATNFCT.
ProDom; PD278081; DUF1916; 1.
SUPFAM; SSF109732; SSF109732; 1.
SUPFAM; SSF50447; SSF50447; 1.
SUPFAM; SSF50465; SSF50465; 1.
SUPFAM; SSF52540; SSF52540; 1.
PROSITE; PS51722; G_TR_2; 1.
1: Evidence at protein level;
3D-structure; Acetylation; Alternative splicing; Complete proteome;
Elongation factor; GTP-binding; Nucleotide-binding; Phosphoprotein;
Polymorphism; Protein biosynthesis; Reference proteome.
CHAIN 1 684 HBS1-like protein.
/FTId=PRO_0000091491.
DOMAIN 258 482 tr-type G. {ECO:0000255|PROSITE-
ProRule:PRU01059}.
NP_BIND 267 274 GTP. {ECO:0000250}.
NP_BIND 344 348 GTP. {ECO:0000250}.
NP_BIND 406 409 GTP. {ECO:0000250}.
REGION 267 274 G1. {ECO:0000255|PROSITE-
ProRule:PRU01059}.
REGION 323 327 G2. {ECO:0000255|PROSITE-
ProRule:PRU01059}.
REGION 344 347 G3. {ECO:0000255|PROSITE-
ProRule:PRU01059}.
REGION 406 409 G4. {ECO:0000255|PROSITE-
ProRule:PRU01059}.
REGION 445 447 G5. {ECO:0000255|PROSITE-
ProRule:PRU01059}.
MOD_RES 49 49 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 67 67 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 117 117 Phosphoserine.
{ECO:0000244|PubMed:20068231}.
MOD_RES 127 127 Phosphoserine.
{ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:23186163}.
MOD_RES 152 152 Phosphoserine.
{ECO:0000250|UniProtKB:Q69ZS7}.
MOD_RES 154 154 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 231 231 Phosphothreonine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 622 622 N6-acetyllysine.
{ECO:0000250|UniProtKB:Q69ZS7}.
VAR_SEQ 37 78 Missing (in isoform 3).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_041068.
VAR_SEQ 145 684 KPVDSQTSRSESEIVPKVAKMTVSGKKQTMGFEVPGVSSEE
NGHSFHTPQKGPPIEDAIASSDVLETASKSANPPHTIQASE
EQSSTPAPVKKSGKLRQQIDVKAELEKRQGGKQLLNLVVIG
HVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFA
YAWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHK
DFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHG
LLVRSLGVTQLAVAVNKMDQVNWQQERFQEITGKLGHFLKQ
AGFKESDVGFIPTSGLSGENLITRSQSSELTKWYKGLCLLE
QIDSFKPPQRSIDKPFRLCVSDVFKDQGSGFCITGKIEAGY
IQTGDRLLAMPPNETCTVKGITLHDEPVDWAAAGDHVSLTL
VGMDIIKINVGCIFCGPKVPIKACTRFRARILIFNIEIPIT
KGFPVLLHYQTVSEPAVIKRLISVLNKSTGEVTKKKPKFLT
KGQNALVELQTQRPIALELYKDFKELGRFMLRYGGSTIAAG
VVTEIKE -> VLFSSSEVSADNVQSSYPQSANHLDYSSKP
FDFASSVGKYGLSHNSSVPTHCLLHRKKKLDTRKSEKKLES
CKLTKELSLANLIHDMSRDSCESQPSVRLSSTDSLESLLSK
NLDADLLRPHASECISKDDSAFKEIPDLKTIIIKGTTPNNS
LYIQNNSLSDFQNIPVQDSLGSSNNPLYLTSSLENMTVDNL
NASKETEVGNVSLVEQSAKNHTFKNDNLQFSQCESPSLTEL
FQEHKENNISQCFTLSDLCNQSSASFTDLSLGSFPLSQLAN
RCQSSPGISELTGSLSSLAFHKASPTRDLENLSLSELIAET
IDVDNSQIKKESFEVSLSEVRSPGIDSNIDLSVLIKNPDFV
PKPVVDPSIAPSSRTKVLSSKLGKNSNFAKDNKKNNKGSLT
RKPPFSLSWTKALAARPSAFASTLCLRYPLKSCKRRTLDLY
KTFLYSRQVQDVKDKEISPLVAITPFDFKSASPDDIVKANQ
KKAFTRE (in isoform 2).
{ECO:0000303|Ref.2}.
/FTId=VSP_013624.
VARIANT 440 440 G -> S (in dbSNP:rs4435957).
/FTId=VAR_048963.
SEQUENCE 684 AA; 75473 MW; D457ACA3941C4B4B CRC64;
MARHRNVRGY NYDEDFEDDD LYGQSVEDDY CISPSTAAQF IYSRRDKPSV EPVEEYDYED
LKESSNSVSN HQLSGFDQAR LYSCLDHMRE VLGDAVPDEI LIEAVLKNKF DVQKALSGVL
EQDRVQSLKD KNEATVSTGK IAKGKPVDSQ TSRSESEIVP KVAKMTVSGK KQTMGFEVPG
VSSEENGHSF HTPQKGPPIE DAIASSDVLE TASKSANPPH TIQASEEQSS TPAPVKKSGK
LRQQIDVKAE LEKRQGGKQL LNLVVIGHVD AGKSTLMGHM LYLLGNINKR TMHKYEQESK
KAGKASFAYA WVLDETGEER ERGVTMDVGM TKFETTTKVI TLMDAPGHKD FIPNMITGAA
QADVAVLVVD ASRGEFEAGF ETGGQTREHG LLVRSLGVTQ LAVAVNKMDQ VNWQQERFQE
ITGKLGHFLK QAGFKESDVG FIPTSGLSGE NLITRSQSSE LTKWYKGLCL LEQIDSFKPP
QRSIDKPFRL CVSDVFKDQG SGFCITGKIE AGYIQTGDRL LAMPPNETCT VKGITLHDEP
VDWAAAGDHV SLTLVGMDII KINVGCIFCG PKVPIKACTR FRARILIFNI EIPITKGFPV
LLHYQTVSEP AVIKRLISVL NKSTGEVTKK KPKFLTKGQN ALVELQTQRP IALELYKDFK
ELGRFMLRYG GSTIAAGVVT EIKE


Related products :

Catalog number Product name Quantity
HBS1L_RAT Rat ELISA Kit FOR HBS1-like protein 96T
'H00010767-P01-25 HBS1-like protein antigen 25
'H00010767-P01-10 HBS1-like protein antigen 10
CSB-EL010160RA Rat HBS1-like protein(HBS1L) ELISA kit 96T
E12753m Mouse ELISA Kit FOR HBS1-like protein 96T
E5788h Human HBS1 Like Protein ELISA Kit 96T
HBS1L_BOVIN Bovine ELISA Kit FOR HBS1-like protein 96T
HBS1L_HUMAN Human ELISA Kit FOR HBS1-like protein 96T
'ARP52212_P050 HBS1-like protein antibody Host rabbit 50
CSB-EL010160HU Human HBS1-like protein(HBS1L) ELISA kit 96T
'H00010767-D01 HBS1-like protein antibody Host Rabbit 0.1 ml
CSB-EL010160BO Bovine HBS1-like protein(HBS1L) ELISA kit 96T
CSB-EL010160MO Mouse HBS1-like protein(HBS1L) ELISA kit 96T
CSB-EL010160RA Rat HBS1-like protein(HBS1L) ELISA kit SpeciesRat 96T
'H00010767-B01P HBS1-like protein antibody Host Mouse 50
CSB-EL010160MO Mouse HBS1-like protein(HBS1L) ELISA kit SpeciesMouse 96T
CSB-EL010160BO Bovine HBS1-like protein(HBS1L) ELISA kit SpeciesBovine 96T
'H00010767-D01P HBS1-like protein antibody Host Rabbit 100
CSB-EL010160HU Human HBS1-like protein(HBS1L) ELISA kit SpeciesHuman 96T
HBS1L_MOUSE ELISA Kit FOR HBS1-like protein; organism: Mouse; gene name: Hbs1l 96T
HBZ HBS1L Gene HBS1-like (S. cerevisiae)
201-20-2485 HBS1L{HBS1-like (S. cerevisiae)}rabbit.pAb 0.2ml
CSB-EL010160RA Rat HBS1-like (S. cerevisiae) (HBS1L) ELISA kit, Species Rat, Sample Type serum, plasma 96T
CSB-EL010160BO Bovine HBS1-like (S. cerevisiae) (HBS1L) ELISA kit, Species Bovine, Sample Type serum, plasma 96T
CSB-EL010160MO Mouse HBS1-like (S. cerevisiae) (HBS1L) ELISA kit, Species Mouse, Sample Type serum, plasma 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur