Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

HLA class I histocompatibility antigen, alpha chain F (CDA12) (HLA F antigen) (Leukocyte antigen F) (MHC class I antigen F)

 HLAF_HUMAN              Reviewed;         346 AA.
P30511; Q5JQI8; Q5JQJ1; Q5SPT5; Q860R0; Q8MGQ1; Q8WLP5; Q95HC0;
Q9TP68;
01-APR-1993, integrated into UniProtKB/Swiss-Prot.
11-JAN-2011, sequence version 3.
28-FEB-2018, entry version 163.
RecName: Full=HLA class I histocompatibility antigen, alpha chain F;
AltName: Full=CDA12;
AltName: Full=HLA F antigen;
AltName: Full=Leukocyte antigen F;
AltName: Full=MHC class I antigen F;
Flags: Precursor;
Name=HLA-F; Synonyms=HLA-5.4, HLAF;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1),
AND VARIANT SER-272.
PubMed=1688605; DOI=10.1084/jem.171.1.1;
Geraghty D.E., Wei X., Orr H.T., Koller B.H.;
"Human leukocyte antigen F (HLA-F). An expressed HLA gene composed of
a class I coding sequence linked to a novel transcribed repetitive
element.";
J. Exp. Med. 171:1-18(1990).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1),
AND VARIANT SER-272.
PubMed=1707659; DOI=10.1093/intimm/2.6.531;
Lury D., Epstein H., Holmes N.;
"The human class I MHC gene HLA-F is expressed in lymphocytes.";
Int. Immunol. 2:531-537(1990).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1),
AND VARIANT SER-272.
PubMed=10727083; DOI=10.3109/10425179909033955;
Hampe A., Coriton O., Andrieux N., Carn G., Lepourcelet M.,
Mottier S., Dreano S., Gatius M.T., Hitte C., Soriano N., Galibert F.;
"A 356-Kb sequence of the subtelomeric part of the MHC class I
region.";
DNA Seq. 10:263-299(1999).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), AND VARIANT SER-272.
PubMed=14705989; DOI=10.1111/j.1399-0039.2004.00145.x;
He X., Xu L., Liu Y., Zeng Y.;
"Identification of a novel HLA-F allele - HLA-F*010102.";
Tissue Antigens 63:181-183(2004).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1),
AND VARIANT SER-272.
PubMed=16570139; DOI=10.1007/s00251-005-0076-z;
Pyo C.W., Williams L.M., Moore Y., Hyodo H., Li S.S., Zhao L.P.,
Sageshima N., Ishitani A., Geraghty D.E.;
"HLA-E, HLA-F, and HLA-G polymorphism: genomic sequence defines
haplotype structure and variation spanning the nonclassical class I
genes.";
Immunogenetics 58:241-251(2006).
[6]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND VARIANT SER-272.
Gharwan H., Sageshima N., Ishitani A., Geraghty D.E.;
"A comparative study of the MHC-F expression patterns between humans
and nonhuman primates.";
Submitted (JAN-2006) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], AND VARIANT SER-272.
Shiina S., Tamiya G., Oka A., Inoko H.;
"Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region.";
Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], AND VARIANT SER-272.
PubMed=14574404; DOI=10.1038/nature02055;
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L.,
Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E.,
Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R.,
Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S.,
Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J.,
Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P.,
Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y.,
Burford D.C., Burrill W., Burton J., Carder C., Carter N.P.,
Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V.,
Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J.,
Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E.,
Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A.,
Frankland J., French L., Garner P., Garnett J., Ghori M.J.,
Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M.,
Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S.,
Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R.,
Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E.,
Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A.,
Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C.,
Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M.,
Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M.,
Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K.,
McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T.,
Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R.,
Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W.,
Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M.,
Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L.,
Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J.,
Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B.,
Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L.,
Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W.,
Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A.,
Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.;
"The DNA sequence and analysis of human chromosome 6.";
Nature 425:805-811(2003).
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), AND VARIANT
SER-272.
TISSUE=Lung, and Lymph;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
-!- FUNCTION: Involved in the presentation of foreign antigens to the
immune system.
-!- SUBUNIT: Heterodimer of an alpha chain and a beta chain (beta-2-
microglobulin).
-!- INTERACTION:
P13747:HLA-E; NbExp=2; IntAct=EBI-2811134, EBI-726583;
P43632:KIR2DS4; NbExp=4; IntAct=EBI-2811134, EBI-13916812;
P43629:KIR3DL1; NbExp=4; IntAct=EBI-2811134, EBI-3910993;
P43630:KIR3DL2; NbExp=6; IntAct=EBI-2811134, EBI-6165894;
Q14943:KIR3DS1; NbExp=6; IntAct=EBI-2811134, EBI-15316524;
-!- SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane
protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=P30511-1; Sequence=Displayed;
Name=2;
IsoId=P30511-2; Sequence=VSP_038846;
Name=3;
IsoId=P30511-3; Sequence=VSP_040349;
Note=Ref.10 (AAH09260) sequence is in conflict in position:
353:N->L. {ECO:0000305};
-!- SIMILARITY: Belongs to the MHC class I family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAC24827.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Sequence=AAH09260.2; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Sequence=BAB63337.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Sequence=CAA34947.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Sequence=CAB46623.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; X17093; CAA34947.1; ALT_SEQ; Genomic_DNA.
EMBL; AF055066; AAC24827.1; ALT_SEQ; Genomic_DNA.
EMBL; AY253269; AAO86773.1; -; mRNA.
EMBL; AY253270; AAO86774.1; -; mRNA.
EMBL; AY253271; AAO86775.1; -; mRNA.
EMBL; AF523284; AAM74979.1; -; Genomic_DNA.
EMBL; AF523285; AAM74980.1; -; Genomic_DNA.
EMBL; AF523286; AAM74981.1; -; Genomic_DNA.
EMBL; AF523287; AAM74982.1; -; Genomic_DNA.
EMBL; AF523288; AAM74983.1; -; Genomic_DNA.
EMBL; AF523289; AAM74984.1; -; Genomic_DNA.
EMBL; AF523290; AAM74985.1; -; Genomic_DNA.
EMBL; AF523291; AAM74986.1; -; Genomic_DNA.
EMBL; AF523292; AAM74987.1; -; Genomic_DNA.
EMBL; AF523293; AAM74988.1; -; Genomic_DNA.
EMBL; AF523294; AAM74989.1; -; Genomic_DNA.
EMBL; AF523295; AAM74990.1; -; Genomic_DNA.
EMBL; AF523296; AAM74991.1; -; Genomic_DNA.
EMBL; AF523297; AAM74992.1; -; Genomic_DNA.
EMBL; AY645742; AAT73225.1; -; Genomic_DNA.
EMBL; AY645743; AAT73226.1; -; Genomic_DNA.
EMBL; AY645744; AAT73227.1; -; Genomic_DNA.
EMBL; AY645745; AAT73228.1; -; Genomic_DNA.
EMBL; AY645746; AAT73229.1; -; Genomic_DNA.
EMBL; AY645748; AAT73231.1; -; Genomic_DNA.
EMBL; AY645749; AAT73232.1; -; Genomic_DNA.
EMBL; AY645750; AAT73233.1; -; Genomic_DNA.
EMBL; AY645751; AAT73234.1; -; Genomic_DNA.
EMBL; AY645752; AAT73235.1; -; Genomic_DNA.
EMBL; AY645753; AAT73236.1; -; Genomic_DNA.
EMBL; AY645754; AAT73237.1; -; Genomic_DNA.
EMBL; AY645756; AAT73239.1; -; Genomic_DNA.
EMBL; AY645757; AAT73240.1; -; Genomic_DNA.
EMBL; AY645758; AAT73241.1; -; Genomic_DNA.
EMBL; AY645759; AAT73242.1; -; Genomic_DNA.
EMBL; DQ367723; ABD38924.1; -; mRNA.
EMBL; BA000025; BAB63337.1; ALT_SEQ; Genomic_DNA.
EMBL; AL022723; CAB46623.1; ALT_SEQ; Genomic_DNA.
EMBL; AL645939; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL669813; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL844851; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BX005428; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CR753818; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BX927250; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471081; EAX03223.1; -; Genomic_DNA.
EMBL; CH471081; EAX03226.1; -; Genomic_DNA.
EMBL; BC009260; AAH09260.2; ALT_INIT; mRNA.
EMBL; BC062991; AAH62991.1; -; mRNA.
CCDS; CCDS43437.1; -. [P30511-3]
CCDS; CCDS43438.1; -. [P30511-1]
CCDS; CCDS43439.1; -. [P30511-2]
PIR; A60384; A60384.
RefSeq; NP_001091948.1; NM_001098478.1. [P30511-2]
RefSeq; NP_001091949.1; NM_001098479.1. [P30511-3]
RefSeq; NP_061823.2; NM_018950.2. [P30511-1]
UniGene; Hs.519972; -.
PDB; 5IUE; X-ray; 2.62 A; A/E/G/I=22-305.
PDB; 5KNM; X-ray; 3.30 A; A=22-305.
PDBsum; 5IUE; -.
PDBsum; 5KNM; -.
ProteinModelPortal; P30511; -.
SMR; P30511; -.
BioGrid; 109379; 20.
IntAct; P30511; 11.
STRING; 9606.ENSP00000259951; -.
iPTMnet; P30511; -.
PhosphoSitePlus; P30511; -.
BioMuta; HLA-F; -.
DMDM; 317373438; -.
PaxDb; P30511; -.
PeptideAtlas; P30511; -.
PRIDE; P30511; -.
DNASU; 3134; -.
Ensembl; ENST00000259951; ENSP00000259951; ENSG00000204642. [P30511-3]
Ensembl; ENST00000334668; ENSP00000334263; ENSG00000204642. [P30511-1]
Ensembl; ENST00000359076; ENSP00000351977; ENSG00000206509. [P30511-2]
Ensembl; ENST00000376848; ENSP00000366044; ENSG00000229698. [P30511-2]
Ensembl; ENST00000376861; ENSP00000366057; ENSG00000204642. [P30511-1]
Ensembl; ENST00000383515; ENSP00000373007; ENSG00000137403. [P30511-2]
Ensembl; ENST00000420067; ENSP00000393535; ENSG00000235220. [P30511-2]
Ensembl; ENST00000434407; ENSP00000397376; ENSG00000204642. [P30511-2]
Ensembl; ENST00000440590; ENSP00000399835; ENSG00000237508. [P30511-2]
GeneID; 3134; -.
KEGG; hsa:3134; -.
UCSC; uc003nnm.5; human. [P30511-1]
CTD; 3134; -.
DisGeNET; 3134; -.
EuPathDB; HostDB:ENSG00000204642.13; -.
GeneCards; HLA-F; -.
HGNC; HGNC:4963; HLA-F.
MIM; 143110; gene.
neXtProt; NX_P30511; -.
OpenTargets; ENSG00000204642; -.
PharmGKB; PA35082; -.
eggNOG; ENOG410IUXN; Eukaryota.
eggNOG; ENOG4111K8F; LUCA.
GeneTree; ENSGT00760000118960; -.
HOGENOM; HOG000296917; -.
HOVERGEN; HBG016709; -.
InParanoid; P30511; -.
KO; K06751; -.
OMA; RITQRFY; -.
PhylomeDB; P30511; -.
TreeFam; TF336617; -.
Reactome; R-HSA-1236974; ER-Phagosome pathway.
Reactome; R-HSA-1236977; Endosomal/Vacuolar pathway.
Reactome; R-HSA-198933; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
Reactome; R-HSA-877300; Interferon gamma signaling.
Reactome; R-HSA-909733; Interferon alpha/beta signaling.
Reactome; R-HSA-983170; Antigen Presentation: Folding, assembly and peptide loading of class I MHC.
SIGNOR; P30511; -.
ChiTaRS; HLA-F; human.
GeneWiki; HLA-F; -.
GenomeRNAi; 3134; -.
PRO; PR:P30511; -.
Proteomes; UP000005640; Chromosome 6.
Bgee; ENSG00000204642; -.
CleanEx; HS_HLA-F; -.
ExpressionAtlas; P30511; baseline and differential.
Genevisible; P30511; HS.
GO; GO:0009986; C:cell surface; IDA:UniProtKB.
GO; GO:0031901; C:early endosome membrane; TAS:Reactome.
GO; GO:0005783; C:endoplasmic reticulum; IDA:UniProtKB.
GO; GO:0012507; C:ER to Golgi transport vesicle membrane; TAS:Reactome.
GO; GO:0000139; C:Golgi membrane; TAS:Reactome.
GO; GO:0071556; C:integral component of lumenal side of endoplasmic reticulum membrane; TAS:Reactome.
GO; GO:0016020; C:membrane; HDA:UniProtKB.
GO; GO:0042612; C:MHC class I protein complex; IEA:UniProtKB-KW.
GO; GO:0030670; C:phagocytic vesicle membrane; TAS:Reactome.
GO; GO:0005886; C:plasma membrane; IBA:GO_Central.
GO; GO:0055038; C:recycling endosome membrane; TAS:Reactome.
GO; GO:0042605; F:peptide antigen binding; IBA:GO_Central.
GO; GO:0005102; F:receptor binding; IBA:GO_Central.
GO; GO:0046978; F:TAP1 binding; IPI:UniProtKB.
GO; GO:0046979; F:TAP2 binding; IPI:UniProtKB.
GO; GO:0002479; P:antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; TAS:Reactome.
GO; GO:0002480; P:antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent; TAS:Reactome.
GO; GO:0002474; P:antigen processing and presentation of peptide antigen via MHC class I; IBA:GO_Central.
GO; GO:0060333; P:interferon-gamma-mediated signaling pathway; TAS:Reactome.
GO; GO:0050776; P:regulation of immune response; TAS:Reactome.
GO; GO:0060337; P:type I interferon signaling pathway; TAS:Reactome.
Gene3D; 2.60.40.10; -; 1.
Gene3D; 3.30.500.10; -; 1.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003006; Ig/MHC_CS.
InterPro; IPR003597; Ig_C1-set.
InterPro; IPR011161; MHC_I-like_Ag-recog.
InterPro; IPR037055; MHC_I-like_Ag-recog_sf.
InterPro; IPR011162; MHC_I/II-like_Ag-recog.
InterPro; IPR001039; MHC_I_a_a1/a2.
Pfam; PF07654; C1-set; 1.
Pfam; PF00129; MHC_I; 1.
PRINTS; PR01638; MHCCLASSI.
SMART; SM00407; IGc1; 1.
SUPFAM; SSF48726; SSF48726; 1.
SUPFAM; SSF54452; SSF54452; 1.
PROSITE; PS50835; IG_LIKE; 1.
PROSITE; PS00290; IG_MHC; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Complete proteome; Disulfide bond;
Glycoprotein; Immunity; Membrane; MHC I; Polymorphism;
Reference proteome; Signal; Transmembrane; Transmembrane helix.
SIGNAL 1 21
CHAIN 22 346 HLA class I histocompatibility antigen,
alpha chain F.
/FTId=PRO_0000018884.
TOPO_DOM 22 305 Extracellular. {ECO:0000255}.
TRANSMEM 306 329 Helical. {ECO:0000255}.
TOPO_DOM 330 346 Cytoplasmic. {ECO:0000255}.
DOMAIN 206 296 Ig-like C1-type.
REGION 22 111 Alpha-1.
REGION 112 203 Alpha-2.
REGION 204 295 Alpha-3.
REGION 296 305 Connecting peptide.
CARBOHYD 107 107 N-linked (GlcNAc...) asparagine.
{ECO:0000250}.
DISULFID 122 185 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 224 280 {ECO:0000255|PROSITE-ProRule:PRU00114}.
VAR_SEQ 204 295 Missing (in isoform 2).
{ECO:0000303|PubMed:14705989}.
/FTId=VSP_038846.
VAR_SEQ 346 346 V -> AYSVVSGNLMITWWSSLFLLGVLFQGYLGCLRSHSV
LGRRKVGDMWILFFLWLWTSFNTAFLALQSLRFGFGFRRGR
SFLLRSWHHLMKRVQIKIFD (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_040349.
VARIANT 13 13 A -> V (in dbSNP:rs17875379).
/FTId=VAR_056525.
VARIANT 71 71 P -> Q (in dbSNP:rs17875380).
/FTId=VAR_056526.
VARIANT 272 272 P -> S (in dbSNP:rs1736924).
{ECO:0000269|PubMed:10727083,
ECO:0000269|PubMed:14574404,
ECO:0000269|PubMed:14705989,
ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:16570139,
ECO:0000269|PubMed:1688605,
ECO:0000269|PubMed:1707659,
ECO:0000269|Ref.6, ECO:0000269|Ref.7}.
/FTId=VAR_018327.
STRAND 24 35 {ECO:0000244|PDB:5IUE}.
TURN 36 38 {ECO:0000244|PDB:5IUE}.
STRAND 39 49 {ECO:0000244|PDB:5IUE}.
STRAND 52 58 {ECO:0000244|PDB:5IUE}.
STRAND 61 63 {ECO:0000244|PDB:5IUE}.
STRAND 67 70 {ECO:0000244|PDB:5IUE}.
HELIX 71 73 {ECO:0000244|PDB:5IUE}.
HELIX 78 105 {ECO:0000244|PDB:5IUE}.
STRAND 115 124 {ECO:0000244|PDB:5IUE}.
STRAND 128 139 {ECO:0000244|PDB:5IUE}.
STRAND 142 147 {ECO:0000244|PDB:5IUE}.
STRAND 154 158 {ECO:0000244|PDB:5IUE}.
HELIX 161 170 {ECO:0000244|PDB:5IUE}.
HELIX 173 182 {ECO:0000244|PDB:5IUE}.
HELIX 184 195 {ECO:0000244|PDB:5IUE}.
HELIX 197 200 {ECO:0000244|PDB:5IUE}.
STRAND 207 214 {ECO:0000244|PDB:5IUE}.
STRAND 216 232 {ECO:0000244|PDB:5IUE}.
STRAND 235 240 {ECO:0000244|PDB:5IUE}.
TURN 246 248 {ECO:0000244|PDB:5KNM}.
STRAND 249 251 {ECO:0000244|PDB:5IUE}.
STRAND 258 260 {ECO:0000244|PDB:5IUE}.
STRAND 262 271 {ECO:0000244|PDB:5IUE}.
HELIX 275 277 {ECO:0000244|PDB:5IUE}.
STRAND 278 283 {ECO:0000244|PDB:5IUE}.
STRAND 287 289 {ECO:0000244|PDB:5IUE}.
STRAND 291 293 {ECO:0000244|PDB:5IUE}.
SEQUENCE 346 AA; 39062 MW; D4782968A67E9B7D CRC64;
MAPRSLLLLL SGALALTDTW AGSHSLRYFS TAVSRPGRGE PRYIAVEYVD DTQFLRFDSD
AAIPRMEPRE PWVEQEGPQY WEWTTGYAKA NAQTDRVALR NLLRRYNQSE AGSHTLQGMN
GCDMGPDGRL LRGYHQHAYD GKDYISLNED LRSWTAADTV AQITQRFYEA EEYAEEFRTY
LEGECLELLR RYLENGKETL QRADPPKAHV AHHPISDHEA TLRCWALGFY PAEITLTWQR
DGEEQTQDTE LVETRPAGDG TFQKWAAVVV PPGEEQRYTC HVQHEGLPQP LILRWEQSPQ
PTIPIVGIVA GLVVLGAVVT GAVVAAVMWR KKSSDRNRGS YSQAAV


Related products :

Catalog number Product name Quantity
E1386h ELISA HLA class I histocompatibility antigen, alpha chain G,HLA G antigen,HLA-6.0,HLAG,HLA-G,Homo sapiens,Human,MHC class I antigen G 96T
E1386h ELISA kit HLA class I histocompatibility antigen, alpha chain G,HLA G antigen,HLA-6.0,HLAG,HLA-G,Homo sapiens,Human,MHC class I antigen G 96T
U1386h CLIA HLA class I histocompatibility antigen, alpha chain G,HLA G antigen,HLA-6.0,HLAG,HLA-G,Homo sapiens,Human,MHC class I antigen G 96T
E1752h ELISA HLA class I histocompatibility antigen, alpha chain E,HLA-6.2,HLAE,HLA-E,Homo sapiens,Human,MHC class I antigen E 96T
U1752h CLIA HLA class I histocompatibility antigen, alpha chain E,HLA-6.2,HLAE,HLA-E,Homo sapiens,Human,MHC class I antigen E 96T
E1752h ELISA kit HLA class I histocompatibility antigen, alpha chain E,HLA-6.2,HLAE,HLA-E,Homo sapiens,Human,MHC class I antigen E 96T
EIAAB11895 HLA class II histocompatibility antigen, DR alpha chain,HLA-DRA,HLA-DRA1,Homo sapiens,Human,MHC class II antigen DRA
EIAAB11449 DMA,HLA class II histocompatibility antigen, DM alpha chain,HLA-DMA,Homo sapiens,Human,MHC class II antigen DMA,Really interesting new gene 6 protein,RING6
EIAAB11884 DX alpha chain,HLA class II histocompatibility antigen, DQ alpha 2 chain,HLA class II histocompatibility antigen, DQ(6) alpha chain,HLA-DQA1,HLA-DQA2,HLA-DXA,Homo sapiens,Human,MHC class II DQA2
EIAAB11729 HLA class II histocompatibility antigen, DP beta 1 chain,HLA class II histocompatibility antigen, DP(W4) beta chain,HLA-DP1B,HLA-DPB1,Homo sapiens,Human,MHC class II antigen DPB1
EIAAB11639 HLA class II histocompatibility antigen, DO alpha chain,HLA-DNA,HLA-DOA,HLA-DZA,Homo sapiens,Human,MHC class II antigen DOA,MHC DN-alpha,MHC DZ alpha
EIAAB11886 HLA class II histocompatibility antigen, DQ beta 2 chain,HLA class II histocompatibility antigen, DX beta chain,HLA-DQB2,HLA-DXB,Homo sapiens,Human,MHC class II antigen DQB2
EIAAB11453 DMB,HLA class II histocompatibility antigen, DM beta chain,HLA-DMB,Homo sapiens,Human,MHC class II antigen DMB,Really interesting new gene 7 protein,RING7
EIAAB11640 HLA class II histocompatibility antigen, DO beta chain,HLA-DOB,Homo sapiens,Human,MHC class II antigen DOB
U1702m CLIA H-2 class I histocompatibility antigen, Q7 alpha chain,H2-Q7,Mouse,Mus musculus,QA-2 antigen 96T
E1702m ELISA kit H-2 class I histocompatibility antigen, Q7 alpha chain,H2-Q7,Mouse,Mus musculus,QA-2 antigen 96T
E1702m ELISA H-2 class I histocompatibility antigen, Q7 alpha chain,H2-Q7,Mouse,Mus musculus,QA-2 antigen 96T
E1555m ELISA H-2 class I histocompatibility antigen, TLA(B) alpha chain,H2-T3,MHC thymus leukemia antigen,Mouse,Mus musculus 96T
U1555m CLIA H-2 class I histocompatibility antigen, TLA(B) alpha chain,H2-T3,MHC thymus leukemia antigen,Mouse,Mus musculus 96T
E1555m ELISA kit H-2 class I histocompatibility antigen, TLA(B) alpha chain,H2-T3,MHC thymus leukemia antigen,Mouse,Mus musculus 96T
EIAAB11885 HLA class II histocompatibility antigen, DQ beta 1 chain,HLA-DQB,HLA-DQB1,Homo sapiens,Human,MHC class II antigen DQB1
EIAAB11903 HLA class II histocompatibility antigen, DR beta 3 chain,HLA-DRB3,Homo sapiens,Human,MHC class II antigen DRB3
EIAAB11904 HLA class II histocompatibility antigen, DR beta 4 chain,HLA-DRB4,Homo sapiens,Human,MHC class II antigen DRB4
EIAAB11726 DP(W3),DP(W4),HLA class II histocompatibility antigen, DP alpha 1 chain,HLA-DP1A,HLA-DPA1,HLASB,HLA-SB alpha chain,Homo sapiens,Human,MHC class II DP3-alpha,MHC class II DPA1
20-321-175233 MHC CLASS II - MONOCLONAL ANTIBODY TO RAT MHC CLASS II; MHC class II antigen; MHC class II histocompatibility antigen SLA-DQB1 Monoclonal 0.1 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur