Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Histone-lysine N-methyltransferase 2C (Lysine N-methyltransferase 2C) (EC 2.1.1.43) (Homologous to ALR protein) (Myeloid/lymphoid or mixed-lineage leukemia protein 3)

 KMT2C_HUMAN             Reviewed;        4911 AA.
Q8NEZ4; Q8NC02; Q8NDF6; Q9H9P4; Q9NR13; Q9P222; Q9UDR7;
10-OCT-2003, integrated into UniProtKB/Swiss-Prot.
20-JAN-2009, sequence version 3.
30-AUG-2017, entry version 162.
RecName: Full=Histone-lysine N-methyltransferase 2C;
Short=Lysine N-methyltransferase 2C;
EC=2.1.1.43;
AltName: Full=Homologous to ALR protein;
AltName: Full=Myeloid/lymphoid or mixed-lineage leukemia protein 3;
Name=KMT2C; Synonyms=HALR, KIAA1506, MLL3;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND VARIANT PRO-526.
TISSUE=Fetal thymus;
PubMed=11891048; DOI=10.1016/S0378-1119(02)00392-X;
Ruault M., Brun M.-E., Ventura M., Roizes G., De Sario A.;
"MLL3, a new human member of the TRX/MLL gene family, maps to 7q36, a
chromosome region frequently deleted in myeloid leukaemia.";
Gene 284:73-81(2002).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
TISSUE=Cervix carcinoma;
PubMed=11718452;
Tan Y.C., Chow V.T.;
"Novel human HALR (MLL3) gene encodes a protein homologous to ALR and
to ALL-1 involved in leukemia, and maps to chromosome 7q36 associated
with leukemia and developmental defects.";
Cancer Detect. Prev. 25:454-469(2001).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12853948; DOI=10.1038/nature01782;
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H.,
Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R.,
Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E.,
Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H.,
Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A.,
Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J.,
Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A.,
Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S.,
Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M.,
Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C.,
Latreille P., Miller N., Johnson D., Murray J., Woessner J.P.,
Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J.,
Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L.,
Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R.,
Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E.,
Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K.,
Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S.,
Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M.,
Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R.,
Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D.,
Waterston R.H., Wilson R.K.;
"The DNA sequence of human chromosome 7.";
Nature 424:157-164(2003).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 556-3865 (ISOFORM 1).
TISSUE=Brain;
PubMed=10819331; DOI=10.1093/dnares/7.2.143;
Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.;
"Prediction of the coding sequences of unidentified human genes. XVII.
The complete sequences of 100 new cDNA clones from brain which code
for large proteins in vitro.";
DNA Res. 7:143-150(2000).
[5]
SEQUENCE REVISION.
PubMed=12168954; DOI=10.1093/dnares/9.3.99;
Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.;
"Construction of expression-ready cDNA clones for KIAA genes: manual
curation of 330 KIAA cDNA clones.";
DNA Res. 9:99-106(2002).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3193-3865 AND 4460-4911.
TISSUE=Placenta;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[7]
PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
TISSUE=Testis;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[8]
INTERACTION WITH MLL2/3 COMPLEX (ISOFORM 2).
TISSUE=Cervix carcinoma;
PubMed=12482968; DOI=10.1128/MCB.23.1.140-149.2003;
Goo Y.-H., Sohn Y.C., Kim D.-H., Kim S.-W., Kang M.-J., Jung D.-J.,
Kwak E., Barlev N.A., Berger S.L., Chow V.T., Roeder R.G.,
Azorsa D.O., Meltzer P.S., Suh P.-G., Song E.J., Lee K.-J., Lee Y.C.,
Lee J.W.;
"Activating signal cointegrator 2 belongs to a novel steady-state
complex that contains a subset of trithorax group proteins.";
Mol. Cell. Biol. 23:140-149(2003).
[9]
IDENTIFICATION IN THE MLL2/3 (ASCOM) COMPLEX.
PubMed=17021013; DOI=10.1073/pnas.0607313103;
Lee S., Lee D.K., Dou Y., Lee J., Lee B., Kwak E., Kong Y.Y.,
Lee S.K., Roeder R.G., Lee J.W.;
"Coactivator as a target gene specificity determinant for histone H3
lysine 4 methyltransferases.";
Proc. Natl. Acad. Sci. U.S.A. 103:15392-15397(2006).
[10]
FUNCTION, ENZYME ACTIVITY, IDENTIFICATION BY MASS SPECTROMETRY, AND
IDENTIFICATION IN THE MLL2/3 COMPLEX.
PubMed=17500065; DOI=10.1074/jbc.M701574200;
Cho Y.-W., Hong T., Hong S., Guo H., Yu H., Kim D., Guszczynski T.,
Dressler G.R., Copeland T.D., Kalkum M., Ge K.;
"PTIP associates with MLL3- and MLL4-containing histone H3 lysine 4
methyltransferase complex.";
J. Biol. Chem. 282:20395-20406(2007).
[11]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[12]
ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-758; LYS-1508; LYS-1772;
LYS-2009; LYS-2802; LYS-2809; LYS-2832 AND LYS-3714, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19608861; DOI=10.1126/science.1175371;
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M.,
Walther T.C., Olsen J.V., Mann M.;
"Lysine acetylation targets protein complexes and co-regulates major
cellular functions.";
Science 325:834-840(2009).
[13]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-46, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=20068231; DOI=10.1126/scisignal.2000475;
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L.,
Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S.,
Mann M.;
"Quantitative phosphoproteomics reveals widespread full
phosphorylation site occupancy during mitosis.";
Sci. Signal. 3:RA3-RA3(2010).
[14]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-89 AND SER-1301, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21406692; DOI=10.1126/scisignal.2001570;
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J.,
Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V.,
Blagoev B.;
"System-wide temporal characterization of the proteome and
phosphoproteome of human embryonic stem cell differentiation.";
Sci. Signal. 4:RS3-RS3(2011).
[15]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-28; SER-113; SER-854;
SER-1987; SER-2828 AND SER-4267, AND IDENTIFICATION BY MASS
SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[16]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-200; SER-3758; SER-4034
AND SER-4267, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
[17]
STRUCTURE BY NMR OF 342-439.
RIKEN structural genomics initiative (RSGI);
"Solution structure of the first and second PHD domain from
myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog.";
Submitted (OCT-2007) to the PDB data bank.
[18]
STRUCTURE BY NMR OF 1624-1713.
RIKEN structural genomics initiative (RSGI);
"Solution structure of the HMG box of human myeloid/lymphoid or mixed-
lineage leukemia protein 3 homolog.";
Submitted (APR-2008) to the PDB data bank.
[19]
VARIANTS [LARGE SCALE ANALYSIS] GLY-347; ASN-400; TRP-478 AND
SER-3698.
PubMed=16959974; DOI=10.1126/science.1133427;
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D.,
Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S.,
Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J.,
Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C.,
Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N.,
Vogelstein B., Kinzler K.W., Velculescu V.E.;
"The consensus coding sequences of human breast and colorectal
cancers.";
Science 314:268-274(2006).
-!- FUNCTION: Histone methyltransferase. Methylates 'Lys-4' of histone
H3. H3 'Lys-4' methylation represents a specific tag for
epigenetic transcriptional activation. Central component of the
MLL2/3 complex, a coactivator complex of nuclear receptors,
involved in transcriptional coactivation. KMT2C/MLL3 may be a
catalytic subunit of this complex. May be involved in
leukemogenesis and developmental disorder.
{ECO:0000269|PubMed:17500065}.
-!- CATALYTIC ACTIVITY: S-adenosyl-L-methionine + L-lysine-[histone] =
S-adenosyl-L-homocysteine + N(6)-methyl-L-lysine-[histone].
{ECO:0000269|PubMed:17500065}.
-!- SUBUNIT: Component of the MLL2/3 complex (also named ASCOM
complex), at least composed of KMT2D/MLL2 or KMT2C/MLL3, ASH2L,
RBBP5, WDR5, NCOA6, DPY30, KDM6A, PAXIP1/PTIP, PAGR1 and
alpha- and beta-tubulin. Interacts with histone H3.
{ECO:0000269|PubMed:17021013, ECO:0000269|PubMed:17500065}.
-!- INTERACTION:
Q14686:NCOA6; NbExp=5; IntAct=EBI-1042997, EBI-78670;
P61964:WDR5; NbExp=4; IntAct=EBI-1042997, EBI-540834;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q8NEZ4-1; Sequence=Displayed;
Name=2;
IsoId=Q8NEZ4-2; Sequence=VSP_008561, VSP_008562, VSP_036223;
Note=No experimental confirmation available.;
Name=3;
IsoId=Q8NEZ4-3; Sequence=VSP_008562;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Highly expressed in testis and ovary, followed
by brain and liver. Also expressed in placenta, peripherical
blood, fetal thymus, heart, lung and kidney. Within brain,
expression was highest in hippocampus, caudate nucleus, and
substantia nigra. Not detected in skeletal muscle and fetal liver.
-!- DOMAIN: The SET domain interacts with histone H3 but not H2A, H2B
and H4, and may have a H3 lysine specific methylation activity.
-!- MISCELLANEOUS: Found in a critical region of chromosome 7, which
is commonly deleted in malignant myeloid disorders. Partial
duplication of the KMT2C gene are found in the juxtacentromeric
region of chromosomes 1, 2, 13 and 21. Juxtacentromeric
reshuffling of the KMT2C gene has generated the BAGE genes.
-!- SIMILARITY: Belongs to the class V-like SAM-binding
methyltransferase superfamily. Histone-lysine methyltransferase
family. TRX/MLL subfamily. {ECO:0000255|PROSITE-ProRule:PRU00190}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AY024361; AAK00583.1; -; mRNA.
EMBL; AF264750; AAF74766.2; -; mRNA.
EMBL; AC006017; AAD45822.1; -; Genomic_DNA.
EMBL; AC104692; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC005631; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AB040939; BAA96030.2; -; mRNA.
EMBL; AK022687; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; AK075113; BAC11409.1; -; mRNA.
EMBL; AL833924; CAD38780.1; -; mRNA.
CCDS; CCDS5931.1; -. [Q8NEZ4-1]
RefSeq; NP_733751.2; NM_170606.2. [Q8NEZ4-1]
UniGene; Hs.647120; -.
PDB; 2YSM; NMR; -; A=342-439.
PDB; 2YUK; NMR; -; A=1631-1713.
PDB; 3UVL; X-ray; 2.20 A; B=4707-4717.
PDB; 4ERY; X-ray; 1.30 A; D=4703-4716.
PDB; 5F59; X-ray; 2.80 A; A=4757-4910.
PDB; 5F6K; X-ray; 2.41 A; C/E=4757-4911.
PDBsum; 2YSM; -.
PDBsum; 2YUK; -.
PDBsum; 3UVL; -.
PDBsum; 4ERY; -.
PDBsum; 5F59; -.
PDBsum; 5F6K; -.
ProteinModelPortal; Q8NEZ4; -.
SMR; Q8NEZ4; -.
BioGrid; 121835; 24.
DIP; DIP-48649N; -.
ELM; Q8NEZ4; -.
IntAct; Q8NEZ4; 18.
MINT; MINT-3042700; -.
STRING; 9606.ENSP00000262189; -.
BindingDB; Q8NEZ4; -.
ChEMBL; CHEMBL2189113; -.
iPTMnet; Q8NEZ4; -.
PhosphoSitePlus; Q8NEZ4; -.
BioMuta; KMT2C; -.
DMDM; 221222521; -.
EPD; Q8NEZ4; -.
MaxQB; Q8NEZ4; -.
PaxDb; Q8NEZ4; -.
PeptideAtlas; Q8NEZ4; -.
PRIDE; Q8NEZ4; -.
Ensembl; ENST00000262189; ENSP00000262189; ENSG00000055609. [Q8NEZ4-1]
Ensembl; ENST00000355193; ENSP00000347325; ENSG00000055609. [Q8NEZ4-1]
GeneID; 58508; -.
KEGG; hsa:58508; -.
UCSC; uc003wla.3; human. [Q8NEZ4-1]
CTD; 58508; -.
DisGeNET; 58508; -.
GeneCards; KMT2C; -.
H-InvDB; HIX0007238; -.
H-InvDB; HIX0016202; -.
H-InvDB; HIX0080234; -.
HGNC; HGNC:13726; KMT2C.
HPA; HPA074736; -.
MIM; 606833; gene.
neXtProt; NX_Q8NEZ4; -.
OpenTargets; ENSG00000055609; -.
PharmGKB; PA30847; -.
eggNOG; KOG4443; Eukaryota.
eggNOG; COG2940; LUCA.
GeneTree; ENSGT00760000119228; -.
HOVERGEN; HBG045586; -.
InParanoid; Q8NEZ4; -.
KO; K09188; -.
OMA; MACQKMA; -.
OrthoDB; EOG091G000H; -.
PhylomeDB; Q8NEZ4; -.
TreeFam; TF354317; -.
Reactome; R-HSA-3214841; PKMTs methylate histone lysines.
Reactome; R-HSA-5617472; Activation of anterior HOX genes in hindbrain development during early embryogenesis.
EvolutionaryTrace; Q8NEZ4; -.
GeneWiki; MLL3; -.
GenomeRNAi; 58508; -.
PRO; PR:Q8NEZ4; -.
Proteomes; UP000005640; Chromosome 7.
Bgee; ENSG00000055609; -.
CleanEx; HS_MLL3; -.
ExpressionAtlas; Q8NEZ4; baseline and differential.
Genevisible; Q8NEZ4; HS.
GO; GO:0035097; C:histone methyltransferase complex; IDA:MGI.
GO; GO:0044666; C:MLL3/4 complex; IDA:UniProtKB.
GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
GO; GO:0005634; C:nucleus; IDA:MGI.
GO; GO:0003677; F:DNA binding; IEA:UniProtKB-KW.
GO; GO:0042800; F:histone methyltransferase activity (H3-K4 specific); IDA:MGI.
GO; GO:0018024; F:histone-lysine N-methyltransferase activity; TAS:Reactome.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0003723; F:RNA binding; IDA:UniProtKB.
GO; GO:0016746; F:transferase activity, transferring acyl groups; IEA:UniProtKB-KW.
GO; GO:0006355; P:regulation of transcription, DNA-templated; IEA:UniProtKB-KW.
GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
Gene3D; 3.30.40.10; -; 6.
InterPro; IPR034732; EPHD.
InterPro; IPR003889; FYrich_C.
InterPro; IPR003888; FYrich_N.
InterPro; IPR009071; HMG_box_dom.
InterPro; IPR000637; HMGI/Y_DNA-bd_CS.
InterPro; IPR003616; Post-SET_dom.
InterPro; IPR001214; SET_dom.
InterPro; IPR011011; Znf_FYVE_PHD.
InterPro; IPR001965; Znf_PHD.
InterPro; IPR019787; Znf_PHD-finger.
InterPro; IPR001841; Znf_RING.
InterPro; IPR013083; Znf_RING/FYVE/PHD.
Pfam; PF05965; FYRC; 1.
Pfam; PF05964; FYRN; 1.
Pfam; PF00628; PHD; 2.
Pfam; PF00856; SET; 1.
SMART; SM00542; FYRC; 1.
SMART; SM00541; FYRN; 1.
SMART; SM00398; HMG; 1.
SMART; SM00249; PHD; 8.
SMART; SM00508; PostSET; 1.
SMART; SM00184; RING; 4.
SMART; SM00317; SET; 1.
SUPFAM; SSF47095; SSF47095; 1.
SUPFAM; SSF57903; SSF57903; 6.
PROSITE; PS50216; DHHC; 1.
PROSITE; PS51805; EPHD; 2.
PROSITE; PS51543; FYRC; 1.
PROSITE; PS51542; FYRN; 1.
PROSITE; PS00354; HMGI_Y; 1.
PROSITE; PS50868; POST_SET; 1.
PROSITE; PS50280; SET; 1.
PROSITE; PS01359; ZF_PHD_1; 5.
PROSITE; PS50016; ZF_PHD_2; 6.
PROSITE; PS50089; ZF_RING_2; 1.
1: Evidence at protein level;
3D-structure; Acetylation; Activator; Acyltransferase;
Alternative splicing; Chromatin regulator; Coiled coil;
Complete proteome; DNA-binding; Lipoprotein; Metal-binding;
Methylation; Methyltransferase; Nucleus; Palmitate; Phosphoprotein;
Polymorphism; Reference proteome; Repeat; S-adenosyl-L-methionine;
Transcription; Transcription regulation; Transferase; Zinc;
Zinc-finger.
CHAIN 1 4911 Histone-lysine N-methyltransferase 2C.
/FTId=PRO_0000124879.
DOMAIN 436 489 DHHC. {ECO:0000255|PROSITE-
ProRule:PRU00067}.
DOMAIN 4545 4605 FYR N-terminal. {ECO:0000255|PROSITE-
ProRule:PRU00875}.
DOMAIN 4606 4691 FYR C-terminal. {ECO:0000255|PROSITE-
ProRule:PRU00876}.
DOMAIN 4771 4887 SET. {ECO:0000255|PROSITE-
ProRule:PRU00190}.
DOMAIN 4895 4911 Post-SET. {ECO:0000255|PROSITE-
ProRule:PRU00155}.
DNA_BIND 34 46 A.T hook.
ZN_FING 227 262 C2HC pre-PHD-type 1; degenerate.
{ECO:0000255|PROSITE-ProRule:PRU01146}.
ZN_FING 283 331 PHD-type 1. {ECO:0000255|PROSITE-
ProRule:PRU01146}.
ZN_FING 341 391 PHD-type 2. {ECO:0000255|PROSITE-
ProRule:PRU00146}.
ZN_FING 344 389 RING-type. {ECO:0000255|PROSITE-
ProRule:PRU00175}.
ZN_FING 388 438 PHD-type 3. {ECO:0000255|PROSITE-
ProRule:PRU00146}.
ZN_FING 464 520 PHD-type 4. {ECO:0000255|PROSITE-
ProRule:PRU00146}.
ZN_FING 957 1010 PHD-type 5. {ECO:0000255|PROSITE-
ProRule:PRU00146}.
ZN_FING 1007 1057 PHD-type 6. {ECO:0000255|PROSITE-
ProRule:PRU00146}.
ZN_FING 1084 1139 PHD-type 7. {ECO:0000255|PROSITE-
ProRule:PRU00146}.
ZN_FING 4399 4439 C2HC pre-PHD-type 2.
{ECO:0000255|PROSITE-ProRule:PRU01146}.
ZN_FING 4460 4507 PHD-type 8. {ECO:0000255|PROSITE-
ProRule:PRU01146}.
REGION 4848 4849 S-adenosyl-L-methionine binding.
{ECO:0000250}.
COILED 92 112 {ECO:0000255}.
COILED 644 672 {ECO:0000255}.
COILED 1338 1366 {ECO:0000255}.
COILED 1754 1787 {ECO:0000255}.
COILED 3054 3081 {ECO:0000255}.
COILED 3173 3272 {ECO:0000255}.
COILED 3391 3433 {ECO:0000255}.
COMPBIAS 1719 1796 Gln-rich.
COMPBIAS 1834 2281 Pro-rich.
COMPBIAS 2412 2630 Pro-rich.
COMPBIAS 2690 2786 Asp-rich.
COMPBIAS 3012 3509 Gln-rich.
COMPBIAS 3277 3381 Pro-rich.
METAL 4851 4851 Zinc. {ECO:0000250}.
METAL 4899 4899 Zinc. {ECO:0000250}.
METAL 4901 4901 Zinc. {ECO:0000250}.
METAL 4906 4906 Zinc. {ECO:0000250}.
BINDING 4825 4825 S-adenosyl-L-methionine.
{ECO:0000255|PROSITE-ProRule:PRU00190}.
MOD_RES 28 28 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 46 46 Phosphoserine.
{ECO:0000244|PubMed:20068231}.
MOD_RES 89 89 Phosphoserine.
{ECO:0000244|PubMed:21406692}.
MOD_RES 113 113 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 200 200 Phosphoserine.
{ECO:0000244|PubMed:24275569}.
MOD_RES 758 758 N6-acetyllysine.
{ECO:0000244|PubMed:19608861}.
MOD_RES 854 854 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 1301 1301 Phosphoserine.
{ECO:0000244|PubMed:21406692}.
MOD_RES 1508 1508 N6-acetyllysine.
{ECO:0000244|PubMed:19608861}.
MOD_RES 1772 1772 N6-acetyllysine.
{ECO:0000244|PubMed:19608861}.
MOD_RES 1987 1987 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 2009 2009 N6-acetyllysine.
{ECO:0000244|PubMed:19608861}.
MOD_RES 2454 2454 Asymmetric dimethylarginine.
{ECO:0000250|UniProtKB:Q8BRH4}.
MOD_RES 2571 2571 Asymmetric dimethylarginine.
{ECO:0000250|UniProtKB:Q8BRH4}.
MOD_RES 2802 2802 N6-acetyllysine.
{ECO:0000244|PubMed:19608861}.
MOD_RES 2809 2809 N6-acetyllysine.
{ECO:0000244|PubMed:19608861}.
MOD_RES 2828 2828 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 2832 2832 N6-acetyllysine.
{ECO:0000244|PubMed:19608861}.
MOD_RES 2867 2867 N6-acetyllysine.
{ECO:0000250|UniProtKB:Q8BRH4}.
MOD_RES 3714 3714 N6-acetyllysine.
{ECO:0000244|PubMed:19608861}.
MOD_RES 3758 3758 Phosphoserine.
{ECO:0000244|PubMed:24275569}.
MOD_RES 4034 4034 Phosphoserine.
{ECO:0000244|PubMed:24275569}.
MOD_RES 4139 4139 Asymmetric dimethylarginine.
{ECO:0000250|UniProtKB:Q8BRH4}.
MOD_RES 4267 4267 Phosphoserine.
{ECO:0000244|PubMed:23186163,
ECO:0000244|PubMed:24275569}.
VAR_SEQ 1 939 Missing (in isoform 2).
{ECO:0000303|PubMed:11718452}.
/FTId=VSP_008561.
VAR_SEQ 3890 3890 Q -> QVRQLSLLPLMEPIIGVNFAHFLPYGSGQFNSGNRL
LGTFGSATLEGVSDYYSQLIYK (in isoform 2 and
isoform 3).
{ECO:0000303|PubMed:11718452}.
/FTId=VSP_008562.
VAR_SEQ 4721 4724 Missing (in isoform 2).
{ECO:0000303|PubMed:11718452}.
/FTId=VSP_036223.
VARIANT 291 291 L -> F (in dbSNP:rs56850341).
/FTId=VAR_061911.
VARIANT 316 316 T -> S (in dbSNP:rs10454320).
/FTId=VAR_061912.
VARIANT 347 347 C -> G (in a colorectal cancer sample;
somatic mutation).
{ECO:0000269|PubMed:16959974}.
/FTId=VAR_036311.
VARIANT 400 400 D -> N (in a colorectal cancer sample;
somatic mutation).
{ECO:0000269|PubMed:16959974}.
/FTId=VAR_036312.
VARIANT 478 478 L -> W (in a colorectal cancer sample;
somatic mutation).
{ECO:0000269|PubMed:16959974}.
/FTId=VAR_036313.
VARIANT 526 526 R -> P (in dbSNP:rs3735156).
{ECO:0000269|PubMed:11891048}.
/FTId=VAR_057360.
VARIANT 823 823 I -> N (in dbSNP:rs2838171).
/FTId=VAR_017118.
VARIANT 823 823 I -> T (in dbSNP:rs2838171).
/FTId=VAR_017117.
VARIANT 1836 1836 S -> N (in dbSNP:rs11771635).
/FTId=VAR_057361.
VARIANT 2008 2008 T -> A (in dbSNP:rs6951159).
/FTId=VAR_057362.
VARIANT 2412 2412 P -> T (in dbSNP:rs13231116).
/FTId=VAR_057363.
VARIANT 2600 2600 P -> A (in dbSNP:rs2270234).
/FTId=VAR_057364.
VARIANT 3698 3698 T -> S (in a colorectal cancer sample;
somatic mutation).
{ECO:0000269|PubMed:16959974}.
/FTId=VAR_036314.
CONFLICT 579 579 A -> T (in Ref. 1; AAK00583).
{ECO:0000305}.
CONFLICT 1286 1286 M -> V (in Ref. 1; AAK00583).
{ECO:0000305}.
CONFLICT 2360 2360 P -> S (in Ref. 1; AAK00583).
{ECO:0000305}.
CONFLICT 2797 2797 K -> R (in Ref. 1; AAK00583).
{ECO:0000305}.
CONFLICT 2882 2882 T -> A (in Ref. 1; AAK00583).
{ECO:0000305}.
CONFLICT 3289 3289 P -> S (in Ref. 6; BAC11409).
{ECO:0000305}.
CONFLICT 3428 3428 R -> W (in Ref. 6; BAC11409).
{ECO:0000305}.
CONFLICT 4613 4613 I -> V (in Ref. 6; AK022687).
{ECO:0000305}.
CONFLICT 4866 4866 H -> P (in Ref. 6; AK022687).
{ECO:0000305}.
TURN 345 347 {ECO:0000244|PDB:2YSM}.
TURN 353 355 {ECO:0000244|PDB:2YSM}.
STRAND 356 358 {ECO:0000244|PDB:2YSM}.
STRAND 360 362 {ECO:0000244|PDB:2YSM}.
TURN 368 372 {ECO:0000244|PDB:2YSM}.
TURN 377 379 {ECO:0000244|PDB:2YSM}.
TURN 386 388 {ECO:0000244|PDB:2YSM}.
TURN 392 394 {ECO:0000244|PDB:2YSM}.
STRAND 403 405 {ECO:0000244|PDB:2YSM}.
STRAND 407 409 {ECO:0000244|PDB:2YSM}.
STRAND 412 414 {ECO:0000244|PDB:2YSM}.
HELIX 415 417 {ECO:0000244|PDB:2YSM}.
STRAND 418 420 {ECO:0000244|PDB:2YSM}.
HELIX 433 436 {ECO:0000244|PDB:2YSM}.
HELIX 1636 1645 {ECO:0000244|PDB:2YUK}.
HELIX 1646 1648 {ECO:0000244|PDB:2YUK}.
STRAND 1650 1652 {ECO:0000244|PDB:2YUK}.
HELIX 1653 1660 {ECO:0000244|PDB:2YUK}.
HELIX 1664 1667 {ECO:0000244|PDB:2YUK}.
HELIX 1671 1684 {ECO:0000244|PDB:2YUK}.
HELIX 1687 1706 {ECO:0000244|PDB:2YUK}.
STRAND 4707 4709 {ECO:0000244|PDB:4ERY}.
HELIX 4758 4768 {ECO:0000244|PDB:5F6K}.
HELIX 4769 4771 {ECO:0000244|PDB:5F6K}.
STRAND 4773 4777 {ECO:0000244|PDB:5F6K}.
STRAND 4779 4789 {ECO:0000244|PDB:5F6K}.
STRAND 4796 4800 {ECO:0000244|PDB:5F6K}.
STRAND 4802 4806 {ECO:0000244|PDB:5F6K}.
HELIX 4807 4817 {ECO:0000244|PDB:5F6K}.
TURN 4818 4821 {ECO:0000244|PDB:5F6K}.
STRAND 4826 4828 {ECO:0000244|PDB:5F6K}.
STRAND 4830 4841 {ECO:0000244|PDB:5F6K}.
HELIX 4843 4846 {ECO:0000244|PDB:5F6K}.
STRAND 4854 4862 {ECO:0000244|PDB:5F6K}.
STRAND 4865 4874 {ECO:0000244|PDB:5F6K}.
STRAND 4908 4910 {ECO:0000244|PDB:5F59}.
SEQUENCE 4911 AA; 541370 MW; 898CEE324772BD75 CRC64;
MSSEEDKSVE QPQPPPPPPE EPGAPAPSPA AADKRPRGRP RKDGASPFQR ARKKPRSRGK
TAVEDEDSMD GLETTETETI VETEIKEQSA EEDAEAEVDN SKQLIPTLQR SVSEESANSL
VSVGVEAKIS EQLCAFCYCG EKSSLGQGDL KQFRITPGFI LPWRNQPSNK KDIDDNSNGT
YEKMQNSAPR KQRGQRKERS PQQNIVSCVS VSTQTASDDQ AGKLWDELSL VGLPDAIDIQ
ALFDSTGTCW AHHRCVEWSL GVCQMEEPLL VNVDKAVVSG STERCAFCKH LGATIKCCEE
KCTQMYHYPC AAGAGTFQDF SHIFLLCPEH IDQAPERSKE DANCAVCDSP GDLLDQFFCT
TCGQHYHGMC LDIAVTPLKR AGWQCPECKV CQNCKQSGED SKMLVCDTCD KGYHTFCLQP
VMKSVPTNGW KCKNCRICIE CGTRSSSQWH HNCLICDNCY QQQDNLCPFC GKCYHPELQK
DMLHCNMCKR WVHLECDKPT DHELDTQLKE EYICMYCKHL GAEMDRLQPG EEVEIAELTT
DYNNEMEVEG PEDQMVFSEQ AANKDVNGQE STPGIVPDAV QVHTEEQQKS HPSESLDTDS
LLIAVSSQHT VNTELEKQIS NEVDSEDLKM SSEVKHICGE DQIEDKMEVT ENIEVVTHQI
TVQQEQLQLL EEPETVVSRE ESRPPKLVME SVTLPLETLV SPHEESISLC PEEQLVIERL
QGEKEQKENS ELSTGLMDSE MTPTIEGCVK DVSYQGGKSI KLSSETESSF SSSADISKAD
VSSSPTPSSD LPSHDMLHNY PSALSSSAGN IMPTTYISVT PKIGMGKPAI TKRKFSPGRP
RSKQGAWSTH NTVSPPSWSP DISEGREIFK PRQLPGSAIW SIKVGRGSGF PGKRRPRGAG
LSGRGGRGRS KLKSGIGAVV LPGVSTADIS SNKDDEENSM HNTVVLFSSS DKFTLNQDMC
VVCGSFGQGA EGRLLACSQC GQCYHPYCVS IKITKVVLSK GWRCLECTVC EACGKATDPG
RLLLCDDCDI SYHTYCLDPP LQTVPKGGWK CKWCVWCRHC GATSAGLRCE WQNNYTQCAP
CASLSSCPVC YRNYREEDLI LQCRQCDRWM HAVCQNLNTE EEVENVADIG FDCSMCRPYM
PASNVPSSDC CESSLVAQIV TKVKELDPPK TYTQDGVCLT ESGMTQLQSL TVTVPRRKRS
KPKLKLKIIN QNSVAVLQTP PDIQSEHSRD GEMDDSREGE LMDCDGKSES SPEREAVDDE
TKGVEGTDGV KKRKRKPYRP GIGGFMVRQR SRTGQGKTKR SVIRKDSSGS ISEQLPCRDD
GWSEQLPDTL VDESVSVTES TEKIKKRYRK RKNKLEETFP AYLQEAFFGK DLLDTSRQSK
ISLDNLSEDG AQLLYKTNMN TGFLDPSLDP LLSSSSAPTK SGTHGPADDP LADISEVLNT
DDDILGIISD DLAKSVDHSD IGPVTDDPSS LPQPNVNQSS RPLSEEQLDG ILSPELDKMV
TDGAILGKLY KIPELGGKDV EDLFTAVLSP ANTQPTPLPQ PPPPTQLLPI HNQDAFSRMP
LMNGLIGSSP HLPHNSLPPG SGLGTFSAIA QSSYPDARDK NSAFNPMASD PNNSWTSSAP
TVEGENDTMS NAQRSTLKWE KEEALGEMAT VAPVLYTNIN FPNLKEEFPD WTTRVKQIAK
LWRKASSQER APYVQKARDN RAALRINKVQ MSNDSMKRQQ QQDSIDPSSR IDSELFKDPL
KQRESEHEQE WKFRQQMRQK SKQQAKIEAT QKLEQVKNEQ QQQQQQQFGS QHLLVQSGSD
TPSSGIQSPL TPQPGNGNMS PAQSFHKELF TKQPPSTPTS TSSDDVFVKP QAPPPPPAPS
RIPIQDSLSQ AQTSQPPSPQ VFSPGSSNSR PPSPMDPYAK MVGTPRPPPV GHSFSRRNSA
APVENCTPLS SVSRPLQMNE TTANRPSPVR DLCSSSTTNN DPYAKPPDTP RPVMTDQFPK
SLGLSRSPVV SEQTAKGPIA AGTSDHFTKP SPRADVFQRQ RIPDSYARPL LTPAPLDSGP
GPFKTPMQPP PSSQDPYGSV SQASRRLSVD PYERPALTPR PIDNFSHNQS NDPYSQPPLT
PHPAVNESFA HPSRAFSQPG TISRPTSQDP YSQPPGTPRP VVDSYSQSSG TARSNTDPYS
QPPGTPRPTT VDPYSQQPQT PRPSTQTDLF VTPVTNQRHS DPYAHPPGTP RPGISVPYSQ
PPATPRPRIS EGFTRSSMTR PVLMPNQDPF LQAAQNRGPA LPGPLVRPPD TCSQTPRPPG
PGLSDTFSRV SPSAARDPYD QSPMTPRSQS DSFGTSQTAH DVADQPRPGS EGSFCASSNS
PMHSQGQQFS GVSQLPGPVP TSGVTDTQNT VNMAQADTEK LRQRQKLREI ILQQQQQKKI
AGRQEKGSQD SPAVPHPGPL QHWQPENVNQ AFTRPPPPYP GNIRSPVAPP LGPRYAVFPK
DQRGPYPPDV ASMGMRPHGF RFGFPGGSHG TMPSQERFLV PPQQIQGSGV SPQLRRSVSV
DMPRPLNNSQ MNNPVGLPQH FSPQSLPVQQ HNILGQAYIE LRHRAPDGRQ RLPFSAPPGS
VVEASSNLRH GNFIPRPDFP GPRHTDPMRR PPQGLPNQLP VHPDLEQVPP SQQEQGHSVH
SSSMVMRTLN HPLGGEFSEA PLSTSVPSET TSDNLQITTQ PSDGLEEKLD SDDPSVKELD
VKDLEGVEVK DLDDEDLENL NLDTEDGKVV ELDTLDNLET NDPNLDDLLR SGEFDIIAYT
DPELDMGDKK SMFNEELDLP IDDKLDNQCV SVEPKKKEQE NKTLVLSDKH SPQKKSTVTN
EVKTEVLSPN SKVESKCETE KNDENKDNVD TPCSQASAHS DLNDGEKTSL HPCDPDLFEK
RTNRETAGPS ANVIQASTQL PAQDVINSCG ITGSTPVLSS LLANEKSDNS DIRPSGSPPP
PTLPASPSNH VSSLPPFIAP PGRVLDNAMN SNVTVVSRVN HVFSQGVQVN PGLIPGQSTV
NHSLGTGKPA TQTGPQTSQS GTSSMSGPQQ LMIPQTLAQQ NRERPLLLEE QPLLLQDLLD
QERQEQQQQR QMQAMIRQRS EPFFPNIDFD AITDPIMKAK MVALKGINKV MAQNNLGMPP
MVMSRFPFMG QVVTGTQNSE GQNLGPQAIP QDGSITHQIS RPNPPNFGPG FVNDSQRKQY
EEWLQETQQL LQMQQKYLEE QIGAHRKSKK ALSAKQRTAK KAGREFPEED AEQLKHVTEQ
QSMVQKQLEQ IRKQQKEHAE LIEDYRIKQQ QQCAMAPPTM MPSVQPQPPL IPGATPPTMS
QPTFPMVPQQ LQHQQHTTVI SGHTSPVRMP SLPGWQPNSA PAHLPLNPPR IQPPIAQLPI
KTCTPAPGTV SNANPQSGPP PRVEFDDNNP FSESFQERER KERLREQQER QRIQLMQEVD
RQRALQQRME MEQHGMVGSE ISSSRTSVSQ IPFYSSDLPC DFMQPLGPLQ QSPQHQQQMG
QVLQQQNIQQ GSINSPSTQT FMQTNERRQV GPPSFVPDSP SIPVGSPNFS SVKQGHGNLS
GTSFQQSPVR PSFTPALPAA PPVANSSLPC GQDSTITHGH SYPGSTQSLI QLYSDIIPEE
KGKKKRTRKK KRDDDAESTK APSTPHSDIT APPTPGISET TSTPAVSTPS ELPQQADQES
VEPVGPSTPN MAAGQLCTEL ENKLPNSDFS QATPNQQTYA NSEVDKLSME TPAKTEEIKL
EKAETESCPG QEEPKLEEQN GSKVEGNAVA CPVSSAQSPP HSAGAPAAKG DSGNELLKHL
LKNKKSSSLL NQKPEGSICS EDDCTKDNKL VEKQNPAEGL QTLGAQMQGG FGCGNQLPKT
DGGSETKKQR SKRTQRTGEK AAPRSKKRKK DEEEKQAMYS STDTFTHLKQ QNNLSNPPTP
PASLPPTPPP MACQKMANGF ATTEELAGKA GVLVSHEVTK TLGPKPFQLP FRPQDDLLAR
ALAQGPKTVD VPASLPTPPH NNQEELRIQD HCGDRDTPDS FVPSSSPESV VGVEVSRYPD
LSLVKEEPPE PVPSPIIPIL PSTAGKSSES RRNDIKTEPG TLYFASPFGP SPNGPRSGLI
SVAITLHPTA AENISSVVAA FSDLLHVRIP NSYEVSSAPD VPSMGLVSSH RINPGLEYRQ
HLLLRGPPPG SANPPRLVSS YRLKQPNVPF PPTSNGLSGY KDSSHGIAES AALRPQWCCH
CKVVILGSGV RKSFKDLTLL NKDSRESTKR VEKDIVFCSN NCFILYSSTA QAKNSENKES
IPSLPQSPMR ETPSKAFHQY SNNISTLDVH CLPQLPEKAS PPASPPIAFP PAFEAAQVEA
KPDELKVTVK LKPRLRAVHG GFEDCRPLNK KWRGMKWKKW SIHIVIPKGT FKPPCEDEID
EFLKKLGTSL KPDPVPKDYR KCCFCHEEGD GLTDGPARLL NLDLDLWVHL NCALWSTEVY
ETQAGALINV ELALRRGLQM KCVFCHKTGA TSGCHRFRCT NIYHFTCAIK AQCMFFKDKT
MLCPMHKPKG IHEQELSYFA VFRRVYVQRD EVRQIASIVQ RGERDHTFRV GSLIFHTIGQ
LLPQQMQAFH SPKALFPVGY EASRLYWSTR YANRRCRYLC SIEEKDGRPV FVIRIVEQGH
EDLVLSDISP KGVWDKILEP VACVRKKSEM LQLFPAYLKG EDLFGLTVSA VARIAESLPG
VEACENYTFR YGRNPLMELP LAVNPTGCAR SEPKMSAHVK RFVLRPHTLN STSTSKSFQS
TVTGELNAPY SKQFVHSKSS QYRKMKTEWK SNVYLARSRI QGLGLYAARD IEKHTMVIEY
IGTIIRNEVA NRKEKLYESQ NRGVYMFRMD NDHVIDATLT GGPARYINHS CAPNCVAEVV
TFERGHKIII SSSRRIQKGE ELCYDYKFDF EDDQHKIPCH CGAVNCRKWM N


Related products :

Catalog number Product name Quantity
EIAAB24941 HALR,Histone-lysine N-methyltransferase MLL3,Homo sapiens,Homologous to ALR protein,Human,KIAA1506,KMT2C,KMT2C,Lysine N-methyltransferase 2C,MLL3,Myeloid_lymphoid or mixed-lineage leukemia protein 3
EIAAB24940 ALL1-related protein,ALR,Histone-lysine N-methyltransferase MLL2,Homo sapiens,Human,KMT2B,KMT2B,Lysine N-methyltransferase 2B,MLL2,Myeloid_lymphoid or mixed-lineage leukemia protein 2
EIAAB24945 Histone-lysine N-methyltransferase MLL5,Homo sapiens,Human,KMT2E,KMT2E,Lysine N-methyltransferase 2E,MLL5,Myeloid_lymphoid or mixed-lineage leukemia protein 5
EIAAB24944 Histone-lysine N-methyltransferase MLL4,Homo sapiens,HRX2,Human,KIAA0304,KMT2D,KMT2D,Lysine N-methyltransferase 2D,MLL2,MLL4,Myeloid_lymphoid or mixed-lineage leukemia protein 4,Trithorax homolog 2,TR
EIAAB11717 DOT1L,DOT1-like protein,H3-K79-HMTase,Histone H3-K79 methyltransferase,Histone-lysine N-methyltransferase, H3 lysine-79 specific,Homo sapiens,Human,KIAA1814,KMT4,Lysine N-methyltransferase 4
EIAAB24942 Histone-lysine N-methyltransferase MLL3,Mll3,Mouse,Mus musculus,Myeloid_lymphoid or mixed-lineage leukemia protein 3 homolog
EIAAB24946 Histone-lysine N-methyltransferase MLL5,Mll5,Mouse,Mus musculus,Myeloid_lymphoid or mixed-lineage leukemia protein 5 homolog
EIAAB12652 Ehmt1,Euchromatic histone-lysine N-methyltransferase 1,Euhmtase1,Eu-HMTase1,G9a-like protein 1,GLP,Glp,GLP1,Histone-lysine N-methyltransferase EHMT1,Kmt1d,Lysine N-methyltransferase 1D,Mouse,Mus muscu
EIAAB37955 ERG-associated protein with SET domain,ESET,H3-K9-HMTase 4,Histone H3-K9 methyltransferase 4,Histone-lysine N-methyltransferase SETDB1,Homo sapiens,Human,KIAA0067,KMT1E,Lysine N-methyltransferase 1E,S
EIAAB37951 Histone-lysine N-methyltransferase SETD1A,Homo sapiens,hSET1A,Human,KIAA0339,KMT2F,Lysine N-methyltransferase 2F,SET domain-containing protein 1A,SET1,Set1_Ash2 histone methyltransferase complex subun
EIAAB37958 C13orf4,Chronic lymphocytic leukemia deletion region gene 8 protein,CLLD8,Histone-lysine N-methyltransferase SETDB2,Homo sapiens,Human,KMT1F,Lysine N-methyltransferase 1F,SET domain bifurcated 2,SETDB
EIAAB24943 Histone-lysine N-methyltransferase MLL4,Mll2,Mouse,Mus musculus,Myeloid_lymphoid or mixed-lineage leukemia protein 4 homolog,Trithorax homolog 2,Trx2,Wbp7,WBP-7,WW domain-binding protein 7
EIAAB37977 H4-K20-HMTase SETD8,Histone-lysine N-methyltransferase SETD8,Homo sapiens,Human,KMT5A,Lysine N-methyltransferase 5A,N-lysine methyltransferase SETD8,PR_SET domain-containing protein 07,PR_SET07,PRSET7
EIAAB12653 EHMT1,Euchromatic histone-lysine N-methyltransferase 1,EUHMTASE1,Eu-HMTase1,G9a-like protein 1,GLP,GLP,GLP1,H3-K9-HMTase 5,Histone H3-K9 methyltransferase 5,Histone-lysine N-methyltransferase EHMT1,Ho
EIAAB37975 H3-K4-HMTase SETD7,Histone H3-K4 methyltransferase SETD7,Histone-lysine N-methyltransferase SETD7,Homo sapiens,Human,KIAA1717,KMT7,Lysine N-methyltransferase 7,SET domain-containing protein 7,SET7,SET
EIAAB40615 H3-K9-HMTase 1,Histone H3-K9 methyltransferase 1,Histone-lysine N-methyltransferase SUV39H1,Homo sapiens,Human,KMT1A,Lysine N-methyltransferase 1A,Position-effect variegation 3-9 homolog,Su(var)3-9 ho
EIAAB40618 H3-K9-HMTase 2,Histone H3-K9 methyltransferase 2,Histone-lysine N-methyltransferase SUV39H2,Homo sapiens,Human,KMT1B,Lysine N-methyltransferase 1B,Su(var)3-9 homolog 2,Suppressor of variegation 3-9 ho
EIAAB38899 Histone methyltransferase SMYD2,Homo sapiens,HSKM-B,Human,KMT3C,Lysine N-methyltransferase 3C,N-lysine methyltransferase SMYD2,SET and MYND domain-containing protein 2,SMYD2
EIAAB27934 DC28,Histone-lysine N-methyltransferase NSD3,Homo sapiens,Human,NSD3,Nuclear SET domain-containing protein 3,Protein whistle,WHSC1L1,WHSC1-like 1 isoform 9 with methyltransferase activity to lysine,WH
EIAAB12655 BAT8,C6orf30,EHMT2,Euchromatic histone-lysine N-methyltransferase 2,G9A,H3-K9-HMTase 3,Histone H3-K9 methyltransferase 3,Histone-lysine N-methyltransferase EHMT2,HLA-B-associated transcript 8,Homo sap
EIAAB12654 Bat8,Ehmt2,Euchromatic histone-lysine N-methyltransferase 2,G9a,H3-K9-HMTase 3,Histone H3-K9 methyltransferase 3,Histone-lysine N-methyltransferase EHMT2,HLA-B-associated transcript 8,Mouse,Mus muscul
EIAAB37954 Histone-lysine N-methyltransferase SETD1B,Homo sapiens,hSET1B,Human,KIAA1076,KMT2G,Lysine N-methyltransferase 2G,SET domain-containing protein 1B,SET1B,SETD1B
EIAAB24938 ALL1,ALL-1,CXXC7,CXXC-type zinc finger protein 7,Histone-lysine N-methyltransferase MLL,Homo sapiens,HRX,HTRX,Human,KMT2A,KMT2A,Lysine N-methyltransferase 2A,MLL,MLL1,Trithorax-like protein,TRX1,Zinc
EIAAB37978 H4-K20-HMTase SETD8,Histone-lysine N-methyltransferase SETD8,Mouse,Mus musculus,N-lysine methyltransferase SETD8,PR_SET domain-containing protein 07,PR_SET07,PR-Set7,SET domain-containing protein 8,Se
EIAAB37979 Bos taurus,Bovine,H4-K20-HMTase SETD8,Histone-lysine N-methyltransferase SETD8,N-lysine methyltransferase SETD8,PR_SET domain-containing protein 07,PR_SET07,PR-Set7,SET domain-containing protein 8,SET


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur