Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Homeodomain-only protein (Lung cancer-associated Y protein) (Not expressed in choriocarcinoma protein 1) (Odd homeobox protein 1)

 HOP_HUMAN               Reviewed;          73 AA.
Q9BPY8; A8K0Z2; E9PB55; G3V294; Q8N0V6; Q96CI1;
01-FEB-2005, integrated into UniProtKB/Swiss-Prot.
01-JUN-2001, sequence version 1.
23-MAY-2018, entry version 134.
RecName: Full=Homeodomain-only protein;
AltName: Full=Lung cancer-associated Y protein;
AltName: Full=Not expressed in choriocarcinoma protein 1;
AltName: Full=Odd homeobox protein 1;
Name=HOPX; Synonyms=HOD, HOP, LAGY, NECC1, OB1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
TISSUE=Heart;
PubMed=14516659; DOI=10.1016/S0925-4773(03)00090-X;
Adu J., Leong F.T., Smith N.R., Leek J.P., Markham A.F.,
Robinson P.A., Mighell A.J.;
"Expression of mOb1, a novel atypical 73 amino acid K50-homeodomain
protein, during mouse development.";
Mech. Dev. 119:S43-S47(2002).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, AND
POSSIBLE INVOLVEMENT IN CHORIOCARCINOMA.
PubMed=12573257; DOI=10.1016/S0888-7543(02)00011-3;
Asanoma K., Matsuda T., Kondo H., Kato K., Kishino T., Niikawa N.,
Wake N., Kato H.;
"NECC1, a candidate choriocarcinoma suppressor gene that encodes a
homeodomain consensus motif.";
Genomics 81:15-25(2003).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, AND
POSSIBLE INVOLVEMENT IN LUNG CANCER.
PubMed=12759545; DOI=10.1159/000070306;
Chen Y., Petersen S., Pacyna-Gengelbach M., Pietas A., Petersen I.;
"Identification of a novel homeobox-containing gene, LAGY, which is
downregulated in lung cancer.";
Oncology 64:450-458(2003).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=B-cell;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
INVOLVEMENT IN HEAD AND NECK SQUAMOUS CELL CARCINOMA.
PubMed=15213722; DOI=10.1038/sj.bjc.6601952;
Lemaire F., Millon R., Muller D., Rabouel Y., Bracco L., Abecassis J.,
Wasylyk B.;
"Loss of HOP tumour suppressor expression in head and neck squamous
cell carcinoma.";
Br. J. Cancer 91:258-261(2004).
[8]
INVOLVEMENT IN ORAL SQUAMOUS CELL CARCINOMA.
PubMed=15381369; DOI=10.1016/j.cancergencyto.2004.01.026;
Toruner G.A., Ulger C., Alkan M., Galante A.T., Rinaggio J., Wilk R.,
Tian B., Soteropoulos P., Hameed M.R., Schwalb M.N., Dermody J.J.;
"Association between gene expression profile and tumor invasion in
oral squamous cell carcinoma.";
Cancer Genet. Cytogenet. 154:27-35(2004).
[9]
FUNCTION, AND INTERACTION WITH HSPA1A; HSPA1B AND HSPA8.
PubMed=27708256; DOI=10.1038/ncomms12882;
Seo J.H., Park J.H., Lee E.J., Vo T.T., Choi H., Kim J.Y., Jang J.K.,
Wee H.J., Lee H.S., Jang S.H., Park Z.Y., Jeong J., Lee K.J.,
Seok S.H., Park J.Y., Lee B.J., Lee M.N., Oh G.T., Kim K.W.;
"ARD1-mediated Hsp70 acetylation balances stress-induced protein
refolding and degradation.";
Nat. Commun. 7:12882-12882(2016).
-!- FUNCTION: Atypical homeodomain protein which does not bind DNA and
is required to modulate cardiac growth and development. Acts via
its interaction with SRF, thereby modulating the expression of
SRF-dependent cardiac-specific genes and cardiac development.
Prevents SRF-dependent transcription either by inhibiting SRF
binding to DNA or by recruiting histone deacetylase (HDAC)
proteins that prevent transcription by SRF. Overexpression causes
cardiac hypertrophy (By similarity). May act as a tumor
suppressor. Acts as a co-chaperone for HSPA1A and HSPA1B chaperone
proteins and assists in chaperone-mediated protein refolding
(PubMed:27708256). {ECO:0000250|UniProtKB:Q8R1H0,
ECO:0000269|PubMed:27708256}.
-!- SUBUNIT: Interacts with serum response factor (SRF). Component of
a large complex containing histone deacetylases such as HDAC2 (By
similarity). Interacts with the acetylated forms of HSPA1A and
HSPA1B. Interacts with HSPA8 (PubMed:27708256).
{ECO:0000250|UniProtKB:Q8R1H0, ECO:0000269|PubMed:27708256}.
-!- INTERACTION:
Q99081:TCF12; NbExp=3; IntAct=EBI-10295883, EBI-722877;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:Q8R1H0}.
Cytoplasm {ECO:0000250|UniProtKB:Q8R1H0}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1; Synonyms=A;
IsoId=Q9BPY8-1; Sequence=Displayed;
Name=2; Synonyms=B;
IsoId=Q9BPY8-2; Sequence=VSP_012659;
Note=Ref.1 (AAM46830/AAM46831) sequences are in conflict in
position: 76:P->L. {ECO:0000305};
Name=3;
IsoId=Q9BPY8-3; Sequence=VSP_047290;
Note=Gene prediction based on EST data.;
Name=4;
IsoId=Q9BPY8-4; Sequence=VSP_047290, VSP_012659;
Note=Gene prediction based on EST data.;
-!- TISSUE SPECIFICITY: Widely expressed. Expressed in the heart,
brain, placenta, lung, skeletal and smooth muscles, uterus,
urinary bladder, kidney and spleen. Down-regulated in some types
of cancer such as lung cancer, choriocarcinoma, head and neck
squamous cell carcinoma and oral squamous cell carcinoma.
{ECO:0000269|PubMed:12573257, ECO:0000269|PubMed:12759545}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF492675; AAM46827.1; -; mRNA.
EMBL; AF492676; AAM46828.1; -; mRNA.
EMBL; AF492677; AAM46829.1; -; mRNA.
EMBL; AF492678; AAM46830.1; -; mRNA.
EMBL; AF492679; AAM46831.1; -; mRNA.
EMBL; AF492680; AAM46832.1; -; mRNA.
EMBL; AF492681; AAM46833.1; -; mRNA.
EMBL; AB059408; BAB40926.1; -; mRNA.
EMBL; AB059409; BAB40927.1; -; mRNA.
EMBL; AB059410; BAB40928.1; -; mRNA.
EMBL; AF454763; AAL56613.1; -; mRNA.
EMBL; AK289707; BAF82396.1; -; mRNA.
EMBL; AC108215; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC014225; AAH14225.1; -; mRNA.
CCDS; CCDS3507.1; -. [Q9BPY8-1]
CCDS; CCDS47062.1; -. [Q9BPY8-3]
CCDS; CCDS54767.1; -. [Q9BPY8-4]
RefSeq; NP_001138931.1; NM_001145459.1. [Q9BPY8-1]
RefSeq; NP_001138932.1; NM_001145460.1. [Q9BPY8-4]
RefSeq; NP_115884.4; NM_032495.5. [Q9BPY8-3]
RefSeq; NP_631957.1; NM_139211.4. [Q9BPY8-1]
RefSeq; NP_631958.1; NM_139212.3. [Q9BPY8-1]
RefSeq; XP_016864218.1; XM_017008729.1. [Q9BPY8-1]
RefSeq; XP_016864219.1; XM_017008730.1. [Q9BPY8-1]
RefSeq; XP_016864220.1; XM_017008731.1. [Q9BPY8-1]
RefSeq; XP_016864221.1; XM_017008732.1. [Q9BPY8-1]
RefSeq; XP_016864222.1; XM_017008733.1. [Q9BPY8-1]
RefSeq; XP_016864223.1; XM_017008734.1. [Q9BPY8-1]
UniGene; Hs.619396; -.
ProteinModelPortal; Q9BPY8; -.
SMR; Q9BPY8; -.
BioGrid; 124117; 11.
IntAct; Q9BPY8; 2.
STRING; 9606.ENSP00000450527; -.
iPTMnet; Q9BPY8; -.
PhosphoSitePlus; Q9BPY8; -.
BioMuta; HOPX; -.
DMDM; 60392394; -.
PaxDb; Q9BPY8; -.
PeptideAtlas; Q9BPY8; -.
PRIDE; Q9BPY8; -.
DNASU; 84525; -.
Ensembl; ENST00000317745; ENSP00000315198; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000337881; ENSP00000337330; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000381255; ENSP00000370654; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000381260; ENSP00000370659; ENSG00000171476. [Q9BPY8-2]
Ensembl; ENST00000420433; ENSP00000396275; ENSG00000171476. [Q9BPY8-3]
Ensembl; ENST00000503639; ENSP00000424101; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000508121; ENSP00000422175; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000553379; ENSP00000452340; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000554144; ENSP00000450527; ENSG00000171476. [Q9BPY8-4]
Ensembl; ENST00000555760; ENSP00000452098; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000556376; ENSP00000451794; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000556614; ENSP00000452003; ENSG00000171476. [Q9BPY8-1]
GeneID; 84525; -.
KEGG; hsa:84525; -.
UCSC; uc003hbz.3; human. [Q9BPY8-1]
CTD; 84525; -.
DisGeNET; 84525; -.
EuPathDB; HostDB:ENSG00000171476.21; -.
GeneCards; HOPX; -.
HGNC; HGNC:24961; HOPX.
HPA; CAB018632; -.
HPA; HPA030180; -.
MIM; 607275; gene.
neXtProt; NX_Q9BPY8; -.
OpenTargets; ENSG00000171476; -.
PharmGKB; PA162391564; -.
eggNOG; KOG0490; Eukaryota.
eggNOG; ENOG410YIJ3; LUCA.
GeneTree; ENSGT00390000017143; -.
HOGENOM; HOG000112932; -.
HOVERGEN; HBG051921; -.
InParanoid; Q9BPY8; -.
OMA; KVSKHPD; -.
OrthoDB; EOG091G1BXE; -.
PhylomeDB; Q9BPY8; -.
SIGNOR; Q9BPY8; -.
ChiTaRS; HOPX; human.
GeneWiki; HOPX; -.
GenomeRNAi; 84525; -.
PRO; PR:Q9BPY8; -.
Proteomes; UP000005640; Chromosome 4.
Bgee; ENSG00000171476; -.
CleanEx; HS_HOPX; -.
Genevisible; Q9BPY8; HS.
GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell.
GO; GO:0005634; C:nucleus; IDA:MGI.
GO; GO:0003677; F:DNA binding; IEA:UniProtKB-KW.
GO; GO:0000981; F:RNA polymerase II transcription factor activity, sequence-specific DNA binding; ISA:NTNU_SB.
GO; GO:0051131; P:chaperone-mediated protein complex assembly; IDA:CAFA.
GO; GO:0045596; P:negative regulation of cell differentiation; IDA:MGI.
GO; GO:0006357; P:regulation of transcription by RNA polymerase II; IBA:GO_Central.
GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
GO; GO:0001829; P:trophectodermal cell differentiation; IDA:MGI.
CDD; cd00086; homeodomain; 1.
InterPro; IPR009057; Homeobox-like_sf.
InterPro; IPR001356; Homeobox_dom.
Pfam; PF00046; Homeobox; 1.
SMART; SM00389; HOX; 1.
SUPFAM; SSF46689; SSF46689; 1.
PROSITE; PS50071; HOMEOBOX_2; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Cytoplasm;
Developmental protein; Homeobox; Nucleus; Proto-oncogene;
Reference proteome; Repressor; Transcription;
Transcription regulation.
CHAIN 1 73 Homeodomain-only protein.
/FTId=PRO_0000049129.
DNA_BIND 3 62 Homeobox; atypical. {ECO:0000255|PROSITE-
ProRule:PRU00108}.
VAR_SEQ 1 1 M -> MLIFLGCYRRRLEERAGTM (in isoform 3
and isoform 4). {ECO:0000305}.
/FTId=VSP_047290.
VAR_SEQ 49 73 KWFKQRLAKWRRSEGLPSECRSVTD -> GSDLISRSKIWH
PESSPQREGYPHDSLPCLAFDYFSLLPPQCKEMV (in
isoform 2 and isoform 4).
{ECO:0000303|PubMed:14516659}.
/FTId=VSP_012659.
CONFLICT 72 72 T -> I (in Ref. 6; AAH14225).
{ECO:0000305}.
SEQUENCE 73 AA; 8260 MW; CE65E4D2A8972022 CRC64;
MSAETASGPT EDQVEILEYN FNKVDKHPDS TTLCLIAAEA GLSEEETQKW FKQRLAKWRR
SEGLPSECRS VTD


Related products :

Catalog number Product name Quantity
EIAAB31191 Bft,Hindlimb-expressed homeobox protein backfoot,Homeobox protein PITX1,Homeobox protein P-OTX,Mouse,Mus musculus,Paired-like homeodomain transcription factor 1,Pituitary homeobox 1,Pituitary OTX-rela
EIAAB31193 BFT,Hindlimb-expressed homeobox protein backfoot,Homeobox protein PITX1,Homo sapiens,Human,Paired-like homeodomain transcription factor 1,Pituitary homeobox 1,PITX1,PTX1
EIAAB27447 Homeobox protein NOBOX,Homeodomain-containing protein OG-2,Mouse,Mus musculus,Newborn ovary homeobox protein,Nobox,Og2x,Oocyte-specific homeobox protein
EIAAB24840 hMix,Homeobox protein MIXL1,Homeodomain protein MIX,Homo sapiens,Human,Mix.1 homeobox-like protein,MIX1 homeobox-like protein 1,MIXL,MIXL1
EIAAB30960 Aristaless homeobox protein homolog,ARIX,ARIX1 homeodomain protein,Homo sapiens,Human,Paired mesoderm homeobox protein 2A,Paired-like homeobox 2A,PHOX2A,PMX2A
EIAAB30959 Aristaless homeobox protein homolog,Arix,ARIX1 homeodomain protein,Paired mesoderm homeobox protein 2A,Paired-like homeobox 2A,Phox2a,Pmx2a,Rat,Rattus norvegicus
EIAAB24841 Homeobox protein MIXL1,Homeodomain protein MIX,Mix,Mix.1 homeobox-like protein,MIX1 homeobox-like protein 1,Mixl1,mMix,Mml,Mouse,Mus musculus
18-003-42195 Homeobox protein SIX6 - Sine oculis homeobox homolog 6; Optic homeobox 2; Homeodomain protein OPTX2 Polyclonal 0.05 mg Aff Pur
EIAAB30961 Aristaless homeobox protein homolog,Arix,Mouse,Mus musculus,Paired mesoderm homeobox protein 2A,Paired-like homeobox 2A,Phox2,Phox2a,PHOX2A homeodomain protein,Pmx2,Pmx2a
18-003-43781 Iroquois-class homeodomain protein IRX-4 - Iroquois homeobox protein 4; Homeodomain protein IRXA3 Polyclonal 0.1 mg Protein A
18-003-42398 Iroquois-class homeodomain protein IRX-1 - Iroquois homeobox protein 1; Homeodomain protein IRXA1 Polyclonal 0.1 mg Protein A
18-003-43944 Iroquois-class homeodomain protein IRX-3 - Iroquois homeobox protein 3; Homeodomain protein IRXB1 Polyclonal 0.1 mg Protein A
18-003-43786 Mix1 homeobox-like protein 1 - Mix.1 homeobox-like protein; Homeodomain protein MIX Polyclonal 0.05 mg Aff Pur
18-003-43167 Diencephalon_mesencephalon homeobox protein 1 - Diencephalon_mesencephalon-expressed brain homeobox gene 1 protein; Paired-like homeobox protein DMBX1; Paired-type homeobox Atx; Orthodenticle homolog 0.05 mg Aff Pur
EIAAB38314 Homeobox protein Og12X,Mouse,Mus musculus,OG-12,Og12x,Paired family homeodomain protein Prx3,Prx3,Short stature homeobox protein 2,Shox2
20-372-60079 iroquois homeobox protein 3 - Mouse monoclonal anti-human IRX3 antibody; Iroquois homeobox protein 3; Homeodomain protein IRXB1 Monoclonal 0.1 mg
EIAAB38535 Homeobox protein SIX6,Homeodomain protein OPTX2,Homo sapiens,Human,Optic homeobox 2,OPTX2,Sine oculis homeobox homolog 6,SIX6,SIX9
EIAAB38534 DM locus-associated homeodomain protein,DMAHP,Homeobox protein SIX5,Homo sapiens,Human,Sine oculis homeobox homolog 5,SIX5
EIAAB45354 Homeobox protein unc-4 homolog,Homeobox protein Uncx4.1,Paired-type homeodomain transcription factor 1,Phd1,Rat,Rattus norvegicus,Uncx,Uncx4.1
EIAAB47173 Kiaa0395,Mouse,Mus musculus,Tix1,Triple homeobox protein 1,Zhx3,Zinc finger and homeodomain protein 3,Zinc fingers and homeoboxes protein 3
EIAAB47171 Homo sapiens,Human,KIAA0395,TIX1,Triple homeobox protein 1,ZHX3,Zinc finger and homeodomain protein 3,Zinc fingers and homeoboxes protein 3
EIAAB11459 Cdmx,Diencephalon_mesencephalon homeobox protein 1,Diencephalon_mesencephalon-expressed brain homeobox gene 1 protein,Dmbx1,Mbx,Mouse,Mus musculus,Orthodenticle homolog 3,Otx3,Paired-like homeobox pro
EIAAB11376 Deleted in lung and esophageal cancer protein 1,Deleted in lung cancer protein 1,DLC1,DLC-1,DLEC1,Homo sapiens,Human
20-372-60100 iroquois homeobox protein 5 (IRX5) - Mouse monoclonal anti-human IRX5 antibody; Iroquois homeobox protein 5; Homeodomain protein IRXB2; IRX-2A Monoclonal 0.1 mg
EIAAB31197 ALL1-responsive protein ARP1,ARP1,Homeobox protein PITX2,Homo sapiens,Human,Paired-like homeodomain transcription factor 2,Pituitary homeobox 2,PITX2,RGS,RIEG,RIEG bicoid-related homeobox transcriptio


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur