Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Indole-3-acetic acid-amido synthetase GH3.2 (EC 6.3.2.-) (Auxin-responsive GH3-like protein 2) (AtGH3-2) (Protein YADOKARI 1)

 GH32_ARATH              Reviewed;         549 AA.
Q9SZT9; F4JS15; Q93Z39; Q9SLU3;
26-APR-2005, integrated into UniProtKB/Swiss-Prot.
22-FEB-2012, sequence version 3.
30-AUG-2017, entry version 96.
RecName: Full=Indole-3-acetic acid-amido synthetase GH3.2;
EC=6.3.2.-;
AltName: Full=Auxin-responsive GH3-like protein 2;
Short=AtGH3-2;
AltName: Full=Protein YADOKARI 1;
Name=GH3.2; Synonyms=BRU6, CF4, YDK1; OrderedLocusNames=At4g37390;
ORFNames=F6G17.40;
Arabidopsis thaliana (Mouse-ear cress).
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae;
Arabidopsis.
NCBI_TaxID=3702;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=cv. Columbia;
PubMed=10617198; DOI=10.1038/47134;
Mayer K.F.X., Schueller C., Wambutt R., Murphy G., Volckaert G.,
Pohl T., Duesterhoeft A., Stiekema W., Entian K.-D., Terryn N.,
Harris B., Ansorge W., Brandt P., Grivell L.A., Rieger M.,
Weichselgartner M., de Simone V., Obermaier B., Mache R., Mueller M.,
Kreis M., Delseny M., Puigdomenech P., Watson M., Schmidtheini T.,
Reichert B., Portetelle D., Perez-Alonso M., Boutry M., Bancroft I.,
Vos P., Hoheisel J., Zimmermann W., Wedler H., Ridley P.,
Langham S.-A., McCullagh B., Bilham L., Robben J.,
van der Schueren J., Grymonprez B., Chuang Y.-J., Vandenbussche F.,
Braeken M., Weltjens I., Voet M., Bastiaens I., Aert R., Defoor E.,
Weitzenegger T., Bothe G., Ramsperger U., Hilbert H., Braun M.,
Holzer E., Brandt A., Peters S., van Staveren M., Dirkse W.,
Mooijman P., Klein Lankhorst R., Rose M., Hauf J., Koetter P.,
Berneiser S., Hempel S., Feldpausch M., Lamberth S., Van den Daele H.,
De Keyser A., Buysshaert C., Gielen J., Villarroel R., De Clercq R.,
van Montagu M., Rogers J., Cronin A., Quail M.A., Bray-Allen S.,
Clark L., Doggett J., Hall S., Kay M., Lennard N., McLay K., Mayes R.,
Pettett A., Rajandream M.A., Lyne M., Benes V., Rechmann S.,
Borkova D., Bloecker H., Scharfe M., Grimm M., Loehnert T.-H.,
Dose S., de Haan M., Maarse A.C., Schaefer M., Mueller-Auer S.,
Gabel C., Fuchs M., Fartmann B., Granderath K., Dauner D., Herzl A.,
Neumann S., Argiriou A., Vitale D., Liguori R., Piravandi E.,
Massenet O., Quigley F., Clabauld G., Muendlein A., Felber R.,
Schnabl S., Hiller R., Schmidt W., Lecharny A., Aubourg S.,
Chefdor F., Cooke R., Berger C., Monfort A., Casacuberta E.,
Gibbons T., Weber N., Vandenbol M., Bargues M., Terol J., Torres A.,
Perez-Perez A., Purnelle B., Bent E., Johnson S., Tacon D., Jesse T.,
Heijnen L., Schwarz S., Scholler P., Heber S., Francs P., Bielke C.,
Frishman D., Haase D., Lemcke K., Mewes H.-W., Stocker S.,
Zaccaria P., Bevan M., Wilson R.K., de la Bastide M., Habermann K.,
Parnell L., Dedhia N., Gnoj L., Schutz K., Huang E., Spiegel L.,
Sekhon M., Murray J., Sheet P., Cordes M., Abu-Threideh J.,
Stoneking T., Kalicki J., Graves T., Harmon G., Edwards J.,
Latreille P., Courtney L., Cloud J., Abbott A., Scott K., Johnson D.,
Minx P., Bentley D., Fulton B., Miller N., Greco T., Kemp K.,
Kramer J., Fulton L., Mardis E., Dante M., Pepin K., Hillier L.W.,
Nelson J., Spieth J., Ryan E., Andrews S., Geisel C., Layman D.,
Du H., Ali J., Berghoff A., Jones K., Drone K., Cotton M., Joshu C.,
Antonoiu B., Zidanic M., Strong C., Sun H., Lamar B., Yordan C.,
Ma P., Zhong J., Preston R., Vil D., Shekher M., Matero A., Shah R.,
Swaby I.K., O'Shaughnessy A., Rodriguez M., Hoffman J., Till S.,
Granat S., Shohdy N., Hasegawa A., Hameed A., Lodhi M., Johnson A.,
Chen E., Marra M.A., Martienssen R., McCombie W.R.;
"Sequence and analysis of chromosome 4 of the plant Arabidopsis
thaliana.";
Nature 402:769-777(1999).
[2]
GENOME REANNOTATION.
STRAIN=cv. Columbia;
The Arabidopsis Information Portal (Araport);
Submitted (MAY-2016) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
STRAIN=cv. Columbia;
PubMed=14593172; DOI=10.1126/science.1088305;
Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J.,
Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F.,
Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.,
Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J.,
Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y.,
Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P.,
Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F.,
Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M.,
Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J.,
Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T.,
Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y.,
Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
"Empirical analysis of transcriptional activity in the Arabidopsis
genome.";
Science 302:842-846(2003).
[4]
NUCLEOTIDE SEQUENCE [MRNA] OF 281-549 (ISOFORM 1).
PubMed=10548732; DOI=10.1016/S0378-1119(99)00403-5;
Kato A., Suzuki M., Kuwahara A., Ooe H., Higano-Inaba K., Komeda Y.;
"Isolation and analysis of cDNA within a 300 kb Arabidopsis thaliana
genomic region located around the 100 map unit of chromosome 1.";
Gene 239:309-316(1999).
[5]
FUNCTION, TISSUE SPECIFICITY, AND INDUCTION.
PubMed=14756757; DOI=10.1046/j.1365-313X.2003.01973.x;
Takase T., Nakazawa M., Ishikawa A., Kawashima M., Ichikawa T.,
Takahashi N., Shimada H., Manabe K., Matsui M.;
"ydk1-D, an auxin-responsive GH3 mutant that is involved in hypocotyl
and root elongation.";
Plant J. 37:471-483(2004).
[6]
FUNCTION, CHARACTERIZATION, AND INDUCTION.
PubMed=15659623; DOI=10.1105/tpc.104.026690;
Staswick P.E., Serban B., Rowe M., Tiryaki I., Maldonado M.T.,
Maldonado M.C., Suza W.;
"Characterization of an Arabidopsis enzyme family that conjugates
amino acids to indole-3-acetic acid.";
Plant Cell 17:616-627(2005).
[7]
NOMENCLATURE.
PubMed=12036261; DOI=10.1023/A:1015207114117;
Hagen G., Guilfoyle T.J.;
"Auxin-responsive gene expression: genes, promoters and regulatory
factors.";
Plant Mol. Biol. 49:373-385(2002).
-!- FUNCTION: Catalyzes the synthesis of indole-3-acetic acid (IAA)-
amino acid conjugates, providing a mechanism for the plant to cope
with the presence of excess auxin. Strongly reactive with Glu,
Gln, Trp, Asp, Ala, Leu, Phe, Gly, Tyr, Met, Ile and Val. Little
or no product formation with His, Ser, Thr, Arg, Lys, or Cys. Also
active on pyruvic and butyric acid analogs of IAA, PAA and the
synthetic auxin naphthaleneacetic acid (NAA). The two chlorinated
synthetic auxin herbicides 2,4-D and 3,6-dichloro-o-anisic acid
(dicamba) cannot be used as substrates.
{ECO:0000269|PubMed:14756757, ECO:0000269|PubMed:15659623}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q9SZT9-1; Sequence=Displayed;
Name=2;
IsoId=Q9SZT9-2; Sequence=VSP_042266;
Note=Constructed according to the conserved gene model. Derived
from EST data. No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Expressed in flowers, pollen, cotyledons,
stipules, true leaves, hypocotyls, and all parts of the roots
except for the primary root tips. {ECO:0000269|PubMed:14756757}.
-!- INDUCTION: By auxin. Down-regulated by blue and far red lights.
{ECO:0000269|PubMed:14756757, ECO:0000269|PubMed:15659623}.
-!- SIMILARITY: Belongs to the IAA-amido conjugating enzyme family.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAA87950.1; Type=Frameshift; Positions=540; Evidence={ECO:0000305};
Sequence=CAB38206.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Sequence=CAB80404.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AL035601; CAB38206.1; ALT_SEQ; Genomic_DNA.
EMBL; AL161591; CAB80404.1; ALT_SEQ; Genomic_DNA.
EMBL; CP002687; AEE86787.1; -; Genomic_DNA.
EMBL; AY058161; AAL25575.1; -; mRNA.
EMBL; AB028224; BAA87950.1; ALT_FRAME; mRNA.
PIR; T04733; T04733.
PIR; T52435; T52435.
RefSeq; NP_195455.1; NM_119902.4. [Q9SZT9-2]
UniGene; At.23361; -.
ProteinModelPortal; Q9SZT9; -.
SMR; Q9SZT9; -.
STRING; 3702.AT4G37390.1; -.
PaxDb; Q9SZT9; -.
PRIDE; Q9SZT9; -.
EnsemblPlants; AT4G37390.1; AT4G37390.1; AT4G37390. [Q9SZT9-2]
GeneID; 829893; -.
Gramene; AT4G37390.1; AT4G37390.1; AT4G37390.
KEGG; ath:AT4G37390; -.
Araport; AT4G37390; -.
TAIR; locus:2126362; AT4G37390.
eggNOG; ENOG410IJ43; Eukaryota.
eggNOG; ENOG410XQH0; LUCA.
HOGENOM; HOG000238302; -.
InParanoid; Q9SZT9; -.
KO; K14487; -.
OMA; KNRPFDA; -.
OrthoDB; EOG093605O7; -.
BioCyc; ARA:AT4G37390-MONOMER; -.
PRO; PR:Q9SZT9; -.
Proteomes; UP000006548; Chromosome 4.
Genevisible; Q9SZT9; AT.
GO; GO:0010279; F:indole-3-acetic acid amido synthetase activity; IDA:TAIR.
GO; GO:0010252; P:auxin homeostasis; TAS:TAIR.
GO; GO:0009733; P:response to auxin; IMP:TAIR.
InterPro; IPR004993; GH3.
PANTHER; PTHR31901; PTHR31901; 1.
Pfam; PF03321; GH3; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Ligase; Reference proteome.
CHAIN 1 549 Indole-3-acetic acid-amido synthetase
GH3.2.
/FTId=PRO_0000203571.
VAR_SEQ 540 549 GDTCGTERYV -> EIRVVRNGTFEELMDYAISRGASINQY
KVPRCVSFTPIMELLDSRVVSAHFSPSLPHWSPERRR (in
isoform 2). {ECO:0000305}.
/FTId=VSP_042266.
CONFLICT 422 422 L -> F (in Ref. 4; BAA87950).
{ECO:0000305}.
CONFLICT 474 474 V -> G (in Ref. 3; AAL25575).
{ECO:0000305}.
SEQUENCE 549 AA; 61827 MW; D2C807C4FD5145D4 CRC64;
MAVDSPLQSR MVSATTSEKD VKALKFIEEM TRNPDSVQEK VLGEILTRNS NTEYLKRFDL
DGVVDRKTFK SKVPVVTYED LKPEIQRISN GDCSPILSSH PITEFLTSSG TSAGERKLMP
TIEEDLDRRQ LLYSLLMPVM NLYVPGLDKG KGLYFLFVKS ESKTSGGLPA RPVLTSYYKS
DHFKRRPYDP YNVYTSPNEA ILCSDSSQSM YAQMLCGLLM RHEVLRLGAV FASGLLRAIS
FLQNNWKELA RDISTGTLSS RIFDPAIKNR MSKILTKPDQ ELAEFLVGVC SQENWEGIIT
KIWPNTKYLD VIVTGAMAQY IPTLEYYSGG LPMACTMYAS SESYFGINLK PMCKPSEVSY
TIMPNMAYFE FLPHNHDGDG AAEASLDETS LVELANVEVG KEYELVITTY AGLYRYRVGD
ILRVTGFHNS APQFKFIRRK NVLLSVESDK TDEAELQKAV ENASRLFAEQ GTRVIEYTSY
AETKTIPGHY VIYWELLGRD QSNALMSEEV MAKCCLEMEE SLNSVYRQSR VADKSIGPLG
DTCGTERYV


Related products :

Catalog number Product name Quantity
AS09 420 Antibody: IAA | indole-3-acetic acid (C1') (1mg), Immunogen: BSA-conjugated, via C1 carboxyl group, indole-3-acetic acid (C1'), Host: rabbit, polyclonal, Confirmed reactivity: IAA | indole-3-acetic ac 1 mg
AS09 441 Antibody: IAA | indole-3-acetic acid (C1') (5mg), Immunogen: BSA-conjugated, via C1 carboxyl group, indole-3-acetic acid (C1'), Host: rabbit, polyclonal, Confirmed reactivity: IAA | indole-3-acetic ac 5 mg
AS09 421 Antibody: IAA | indole-3-acetic acid (N1) (for immunolocalization), Immunogen: BSA-conjugated, via C1 carobxyl group, indole-3-acetic acid (N1), Host: rabbit, polyclonal, Confirmed reactivity: indole- 200
AS09 445 Antibody: IAA | indole-3-acetic acid (C1') (for immunolocalization), Immunogen: BSA- conjugated, via C1 carboxyl group, indole-3-acetic acid (C1'), Host: rabbit, polyclonal, Confirmed reactivity: indo 200
AS06 193 Antibody: IAA | indole 3 acetic acid, Immunogen: BSA-conjugated synthetic indole 3 acetic acid, Host: rabbit, polyclonal, Confirmed reactivity: Arabidoppsis thaliana, Euphorbia pulcherrima, Medicago s 100
AS06 193 Indole 3 acetic acid (IAA) 0.1 ml
CI003 Indole-3-acetic acid 5x25g
IB0723 3-Indole acetic acid (IAA) 100g
AS06 193 IAA | indole 3 acetic acid 100 ul
I885-5G INDOLE-3 - ACETIC ACID
AS06193 IAA | indole 3 acetic acid 100 ul
AS06 193 Indole 3 acetic acid (IAA) 0.1 ml
IB0723 3-Indole acetic acid (IAA) 25g
CI002 Indole-3-acetic acid 5x5g
CP052-025 Indole-3-acetic Acid (IAA) 25g x 5
30631010-2 Indole-3-acetic acid (IAA) 10 g
I014-5g Indole-3-acetic acid 5 g
M12865413 Indole-3-acetic acid CAS: [87-51-4] 100 g
30631010-3 Indole-3-acetic acid (IAA) 25 g
30631010-4 Indole-3-acetic acid (IAA) 100 g
CP052-100 Indole-3-acetic Acid (IAA) 100g
CP052-025 Indole-3-acetic Acid (IAA) 25g
30631010-1 Indole-3-acetic acid (IAA) 5 g
I885-25G INDOLE-3 - ACETIC ACID
I014-25g Indole-3-acetic acid 25 g


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur