Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Intercellular adhesion molecule 1 (ICAM-1) (MALA-2) (MyD10) (CD antigen CD54)

 ICAM1_MOUSE             Reviewed;         537 AA.
P13597; Q61828;
01-JAN-1990, integrated into UniProtKB/Swiss-Prot.
01-JAN-1990, sequence version 1.
22-NOV-2017, entry version 182.
RecName: Full=Intercellular adhesion molecule 1;
Short=ICAM-1;
AltName: Full=MALA-2;
AltName: Full=MyD10;
AltName: CD_antigen=CD54;
Flags: Precursor;
Name=Icam1; Synonyms=Icam-1;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA], AND PARTIAL PROTEIN SEQUENCE.
STRAIN=BALB/cJ; TISSUE=Myeloma;
PubMed=2573511;
Horley K.J., Carpenito C., Baker B., Takei F.;
"Molecular cloning of murine intercellular adhesion molecule (ICAM-
1).";
EMBO J. 8:2889-2896(1989).
[2]
SEQUENCE REVISION.
Takei F.;
Submitted (APR-1990) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [MRNA].
PubMed=2479693;
Siu G., Hedrick S.M., Brian A.A.;
"Isolation of the murine intercellular adhesion molecule 1 (ICAM-1)
gene. ICAM-1 enhances antigen-specific T cell activation.";
J. Immunol. 143:3813-3820(1989).
[4]
NUCLEOTIDE SEQUENCE [MRNA].
STRAIN=C57BL/6 X CBA; TISSUE=Thymus;
PubMed=2762164; DOI=10.1093/nar/17.14.5853;
Ballantyne C.M., O'Brien W.E., Beaudet A.L.;
"Nucleotide sequence of the cDNA for murine intercellular adhesion
molecule-1 (ICAM-1).";
Nucleic Acids Res. 17:5853-5853(1989).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
STRAIN=NIH Swiss;
PubMed=1362180; DOI=10.1016/S0888-7543(05)80132-6;
Ballantyne C.M., Sligh J.E., Dai X.Y., Beaudet A.L.;
"Characterization of the murine Icam-1 gene.";
Genomics 14:1076-1080(1992).
[6]
NUCLEOTIDE SEQUENCE [MRNA] OF 4-131.
PubMed=1690380;
Lord K.A., Hoffman-Liebermann B., Liebermann D.A.;
"Complexity of the immediate early response of myeloid cells to
terminal differentiation and growth arrest includes ICAM-1, Jun-B and
histone variants.";
Oncogene 5:387-396(1990).
[7]
GLYCOSYLATION AT ASN-47; ASN-185; ASN-204; ASN-267; ASN-311; ASN-362;
ASN-388; ASN-409 AND ASN-456, LACK OF GLYCOSYLATION AT ASN-469 AND
ASN-485, AND IDENTIFICATION BY MASS SPECTROMETRY.
PubMed=16877748; DOI=10.1093/glycob/cwl032;
Otto V.I., Damoc E., Cueni L.N., Schurpf T., Frei R., Ali S.,
Callewaert N., Moise A., Leary J.A., Folkers G., Przybylski M.;
"N-glycan structures and N-glycosylation sites of mouse soluble
intercellular adhesion molecule-1 revealed by MALDI-TOF and FTICR mass
spectrometry.";
Glycobiology 16:1033-1044(2006).
[8]
GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-185; ASN-204; ASN-362;
ASN-388; ASN-409 AND ASN-469.
PubMed=19349973; DOI=10.1038/nbt.1532;
Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M.,
Schiess R., Aebersold R., Watts J.D.;
"Mass-spectrometric identification and relative quantification of N-
linked cell surface glycoproteins.";
Nat. Biotechnol. 27:378-386(2009).
[9]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Heart, Kidney, Liver, Lung, Spleen, and Testis;
PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
"A tissue-specific atlas of mouse protein phosphorylation and
expression.";
Cell 143:1174-1189(2010).
-!- FUNCTION: ICAM proteins are ligands for the leukocyte adhesion
protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-
endothelial migration, ICAM1 engagement promotes the assembly of
endothelial apical cups through ARHGEF26/SGEF and RHOG activation
(By similarity). {ECO:0000250}.
-!- SUBUNIT: Homodimer. Interacts with MUC1 and promotes cell
aggregation in epithelial cells. Interacts with ARHGEF26/SGEF (By
similarity). {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane
protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=P13597-1; Sequence=Displayed;
Name=2;
IsoId=P13597-2; Sequence=VSP_002518;
-!- TISSUE SPECIFICITY: Expressed at low level on a subpopulation of
lymphocytes, macrophages, and endothelial cells, but is strongly
induced on these cells, and on fibroblasts and epithelial cells.
-!- PTM: Monoubiquitinated, which is promoted by MARCH9 and leads to
endocytosis. {ECO:0000250}.
-!- SIMILARITY: Belongs to the immunoglobulin superfamily. ICAM
family. {ECO:0000305}.
-!- WEB RESOURCE: Name=Functional Glycomics Gateway - Glycan Binding;
Note=ICAM-1;
URL="http://www.functionalglycomics.org/glycomics/GBPServlet?&operationType=view&cbpId=cbp_mou_Itlect_288";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; X16624; CAA34621.1; -; mRNA.
EMBL; X16625; CAA34622.1; -; mRNA.
EMBL; M31585; AAA37876.1; -; mRNA.
EMBL; X52264; CAA36507.1; -; mRNA.
EMBL; M90551; AAA37875.1; -; Genomic_DNA.
EMBL; M90546; AAA37875.1; JOINED; Genomic_DNA.
EMBL; M90547; AAA37875.1; JOINED; Genomic_DNA.
EMBL; M90548; AAA37875.1; JOINED; Genomic_DNA.
EMBL; M90549; AAA37875.1; JOINED; Genomic_DNA.
EMBL; M90550; AAA37875.1; JOINED; Genomic_DNA.
EMBL; X54331; -; NOT_ANNOTATED_CDS; mRNA.
CCDS; CCDS22889.1; -. [P13597-1]
PIR; A45815; A45815.
PIR; I49769; I49769.
PIR; S06016; S06016.
RefSeq; NP_034623.1; NM_010493.3. [P13597-1]
UniGene; Mm.435508; -.
ProteinModelPortal; P13597; -.
SMR; P13597; -.
DIP; DIP-29096N; -.
IntAct; P13597; 2.
MINT; MINT-4098375; -.
STRING; 10090.ENSMUSP00000083587; -.
iPTMnet; P13597; -.
PhosphoSitePlus; P13597; -.
PaxDb; P13597; -.
PeptideAtlas; P13597; -.
PRIDE; P13597; -.
Ensembl; ENSMUST00000086399; ENSMUSP00000083587; ENSMUSG00000037405. [P13597-1]
GeneID; 15894; -.
KEGG; mmu:15894; -.
UCSC; uc009ojx.1; mouse. [P13597-1]
CTD; 3383; -.
MGI; MGI:96392; Icam1.
eggNOG; ENOG410IPHM; Eukaryota.
eggNOG; ENOG410YQ1Q; LUCA.
GeneTree; ENSGT00530000063246; -.
HOGENOM; HOG000059554; -.
HOVERGEN; HBG052074; -.
InParanoid; P13597; -.
KO; K06490; -.
OMA; QTLRCQA; -.
OrthoDB; EOG091G022Y; -.
PhylomeDB; P13597; -.
TreeFam; TF333745; -.
Reactome; R-MMU-198933; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
Reactome; R-MMU-216083; Integrin cell surface interactions.
PRO; PR:P13597; -.
Proteomes; UP000000589; Chromosome 9.
Bgee; ENSMUSG00000037405; -.
CleanEx; MM_ICAM1; -.
ExpressionAtlas; P13597; baseline and differential.
Genevisible; P13597; MM.
GO; GO:0009986; C:cell surface; ISO:MGI.
GO; GO:0009897; C:external side of plasma membrane; IDA:MGI.
GO; GO:0070062; C:extracellular exosome; ISO:MGI.
GO; GO:0031012; C:extracellular matrix; ISO:MGI.
GO; GO:0005615; C:extracellular space; ISO:MGI.
GO; GO:0005925; C:focal adhesion; ISO:MGI.
GO; GO:0001772; C:immunological synapse; IDA:MGI.
GO; GO:0005887; C:integral component of plasma membrane; IBA:GO_Central.
GO; GO:0016020; C:membrane; ISO:MGI.
GO; GO:0005178; F:integrin binding; ISO:MGI.
GO; GO:0002438; P:acute inflammatory response to antigenic stimulus; IEA:Ensembl.
GO; GO:0044406; P:adhesion of symbiont to host; ISO:MGI.
GO; GO:0007155; P:cell adhesion; IDA:MGI.
GO; GO:0033627; P:cell adhesion mediated by integrin; IDA:MGI.
GO; GO:0007569; P:cell aging; IEA:Ensembl.
GO; GO:0071312; P:cellular response to alkaloid; IEA:Ensembl.
GO; GO:0071549; P:cellular response to dexamethasone stimulus; IEA:Ensembl.
GO; GO:0071333; P:cellular response to glucose stimulus; IDA:MGI.
GO; GO:0071456; P:cellular response to hypoxia; IEA:Ensembl.
GO; GO:0071346; P:cellular response to interferon-gamma; IEA:Ensembl.
GO; GO:0071347; P:cellular response to interleukin-1; IEA:Ensembl.
GO; GO:0071354; P:cellular response to interleukin-6; IEA:Ensembl.
GO; GO:1990830; P:cellular response to leukemia inhibitory factor; IEP:MGI.
GO; GO:0071222; P:cellular response to lipopolysaccharide; IEA:Ensembl.
GO; GO:0031669; P:cellular response to nutrient levels; IEA:Ensembl.
GO; GO:0071356; P:cellular response to tumor necrosis factor; IEA:Ensembl.
GO; GO:0061028; P:establishment of endothelial barrier; ISO:MGI.
GO; GO:0090557; P:establishment of endothelial intestinal barrier; IEA:Ensembl.
GO; GO:0097368; P:establishment of Sertoli cell barrier; IEA:Ensembl.
GO; GO:0007159; P:leukocyte cell-cell adhesion; IMP:MGI.
GO; GO:0050900; P:leukocyte migration; IEA:Ensembl.
GO; GO:0022614; P:membrane to membrane docking; IEA:Ensembl.
GO; GO:0051926; P:negative regulation of calcium ion transport; IEA:Ensembl.
GO; GO:2000352; P:negative regulation of endothelial cell apoptotic process; ISO:MGI.
GO; GO:1902042; P:negative regulation of extrinsic apoptotic signaling pathway via death domain receptors; ISO:MGI.
GO; GO:0001541; P:ovarian follicle development; IEA:Ensembl.
GO; GO:0030838; P:positive regulation of actin filament polymerization; IEA:Ensembl.
GO; GO:0002693; P:positive regulation of cellular extravasation; ISO:MGI.
GO; GO:0070374; P:positive regulation of ERK1 and ERK2 cascade; ISO:MGI.
GO; GO:0043547; P:positive regulation of GTPase activity; IEA:Ensembl.
GO; GO:1904996; P:positive regulation of leukocyte adhesion to vascular endothelial cell; IEA:Ensembl.
GO; GO:0051092; P:positive regulation of NF-kappaB transcription factor activity; IEA:Ensembl.
GO; GO:0045429; P:positive regulation of nitric oxide biosynthetic process; IEA:Ensembl.
GO; GO:0050731; P:positive regulation of peptidyl-tyrosine phosphorylation; IEA:Ensembl.
GO; GO:0045907; P:positive regulation of vasoconstriction; IEA:Ensembl.
GO; GO:0046813; P:receptor-mediated virion attachment to host cell; ISO:MGI.
GO; GO:0030155; P:regulation of cell adhesion; IDA:MGI.
GO; GO:0008360; P:regulation of cell shape; IEA:Ensembl.
GO; GO:1900027; P:regulation of ruffle assembly; IDA:MGI.
GO; GO:0043200; P:response to amino acid; IEA:Ensembl.
GO; GO:0001975; P:response to amphetamine; IEA:Ensembl.
GO; GO:0046688; P:response to copper ion; IEA:Ensembl.
GO; GO:0042493; P:response to drug; IEA:Ensembl.
GO; GO:0045471; P:response to ethanol; IEA:Ensembl.
GO; GO:0034698; P:response to gonadotropin; IEA:Ensembl.
GO; GO:0032868; P:response to insulin; IEA:Ensembl.
GO; GO:0010212; P:response to ionizing radiation; IEA:Ensembl.
GO; GO:0010477; P:response to sulfur dioxide; IEA:Ensembl.
GO; GO:0007605; P:sensory perception of sound; IEA:Ensembl.
GO; GO:0002291; P:T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell; ISO:MGI.
GO; GO:0002457; P:T cell antigen processing and presentation; IDA:MGI.
Gene3D; 2.60.40.10; -; 7.
InterPro; IPR003988; ICAM.
InterPro; IPR013768; ICAM_N.
InterPro; IPR003987; ICAM_VCAM_N.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003599; Ig_sub.
Pfam; PF03921; ICAM_N; 1.
Pfam; PF13895; Ig_2; 1.
PRINTS; PR01473; ICAM.
PRINTS; PR01472; ICAMVCAM1.
SMART; SM00409; IG; 4.
SUPFAM; SSF48726; SSF48726; 5.
PROSITE; PS50835; IG_LIKE; 1.
1: Evidence at protein level;
Alternative splicing; Cell adhesion; Complete proteome;
Direct protein sequencing; Disulfide bond; Glycoprotein;
Immunoglobulin domain; Membrane; Reference proteome; Repeat; Signal;
Transmembrane; Transmembrane helix; Ubl conjugation.
SIGNAL 1 27 {ECO:0000250}.
CHAIN 28 537 Intercellular adhesion molecule 1.
/FTId=PRO_0000014785.
TOPO_DOM 28 485 Extracellular. {ECO:0000255}.
TRANSMEM 486 509 Helical. {ECO:0000255}.
TOPO_DOM 510 537 Cytoplasmic. {ECO:0000255}.
DOMAIN 41 102 Ig-like C2-type 1.
DOMAIN 127 195 Ig-like C2-type 2.
DOMAIN 232 299 Ig-like C2-type 3.
DOMAIN 327 381 Ig-like C2-type 4.
DOMAIN 415 468 Ig-like C2-type 5.
MOTIF 151 153 Cell attachment site; atypical.
{ECO:0000255}.
MOTIF 179 181 Cell attachment site. {ECO:0000255}.
SITE 469 469 Not glycosylated.
{ECO:0000269|PubMed:16877748}.
SITE 485 485 Not glycosylated.
{ECO:0000269|PubMed:16877748}.
CARBOHYD 47 47 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:16877748}.
CARBOHYD 185 185 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:16877748,
ECO:0000269|PubMed:19349973}.
CARBOHYD 204 204 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:16877748,
ECO:0000269|PubMed:19349973}.
CARBOHYD 267 267 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:16877748}.
CARBOHYD 311 311 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:16877748}.
CARBOHYD 362 362 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:16877748,
ECO:0000269|PubMed:19349973}.
CARBOHYD 388 388 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:16877748,
ECO:0000269|PubMed:19349973}.
CARBOHYD 409 409 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:16877748,
ECO:0000269|PubMed:19349973}.
CARBOHYD 456 456 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:16877748}.
CARBOHYD 469 469 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:19349973}.
DISULFID 48 91 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 52 95 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 134 188 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 239 292 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 334 374 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 406 422 {ECO:0000250|UniProtKB:P05362}.
DISULFID 422 461 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 434 461 {ECO:0000250|UniProtKB:P05362}.
VAR_SEQ 1 34 MASTRAKPTLPLLLALVTVVIPGPGDAQVSIHPR -> MIT
HRHPVREKSINSYQFIKEKQFPAEN (in isoform 2).
{ECO:0000305}.
/FTId=VSP_002518.
CONFLICT 243 243 G -> A (in Ref. 3; AAA37876).
{ECO:0000305}.
CONFLICT 370 370 R -> A (in Ref. 1; CAA34621).
{ECO:0000305}.
SEQUENCE 537 AA; 58844 MW; 6124167753774555 CRC64;
MASTRAKPTL PLLLALVTVV IPGPGDAQVS IHPREAFLPQ GGSVQVNCSS SCKEDLSLGL
ETQWLKDELE SGPNWKLFEL SEIGEDSSPL CFENCGTVQS SASATITVYS FPESVELRPL
PAWQQVGKDL TLRCHVDGGA PRTQLSAVLL RGEEILSRQP VGGHPKDPKE ITFTVLASRG
DHGANFSCRT ELDLRPQGLA LFSNVSEARS LRTFDLPATI PKLDTPDLLE VGTQQKLFCS
LEGLFPASEA RIYLELGGQM PTQESTNSSD SVSATALVEV TEEFDRTLPL RCVLELADQI
LETQRTLTVY NFSAPVLTLS QLEVSEGSQV TVKCEAHSGS KVVLLSGVEP RPPTPQVQFT
LNASSEDHKR SFFCSAALEV AGKFLFKNQT LELHVLYGPR LDETDCLGNW TWQEGSQQTL
KCQAWGNPSP KMTCRRKADG ALLPIGVVKS VKQEMNGTYV CHAFSSHGNV TRNVYLTVLY
HSQNNWTIII LVPVLLVIVG LVMAASYVYN RQRKIRIYKL QKAQEEAIKL KGQAPPP


Related products :

Catalog number Product name Quantity
U0048m CLIA Icam1,ICAM-1,Icam-1,Intercellular adhesion molecule 1,MALA-2,Mouse,Mus musculus,MyD10 96T
E0048m ELISA kit Icam1,ICAM-1,Icam-1,Intercellular adhesion molecule 1,MALA-2,Mouse,Mus musculus,MyD10 96T
E0048m ELISA Icam1,ICAM-1,Icam-1,Intercellular adhesion molecule 1,MALA-2,Mouse,Mus musculus,MyD10 96T
10-663-45658 Intercellular Adhesion Molecule-1 (ICAM-1) Human - ICAM-1; Major group rhinovirus receptor; CD54 antigen N_A 0.002 mg
10-663-45658 Intercellular Adhesion Molecule-1 (ICAM-1) Human - ICAM-1; Major group rhinovirus receptor; CD54 antigen N_A 0.01 mg
10-663-45658 Intercellular Adhesion Molecule-1 (ICAM-1) Human - ICAM-1; Major group rhinovirus receptor; CD54 antigen N_A 1 mg
CSB-E08898c Dog intercellular adhesion molecule 1,ICAM-1 per CD54 ELISA Kit 96T
CSB-E06974Rb rabbit intercellular adhesion molecule 1,ICAM-1 per CD54 ELISA Kit 96T
UB-E70147 Canine intercellular adhesion molecule 1,ICAM-1 per CD54 ELISA Kit 96T
UB-E70049 Canine intercellular adhesion molecule 1,ICAM-1 per CD54 ELISA Kit 96T
UB-E80012 Chicken intercellular adhesion molecule 1,ICAM-1 per CD54 ELISA Kit 96T
228-10812-1 Recombinant Human Intercellular Adhesion Molecule-1 (ICAM-1) _ CD54 2
228-10812-2 Recombinant Human Intercellular Adhesion Molecule-1 (ICAM-1) _ CD54 10
UB-E30194 rabbit intercellular adhesion molecule 1,ICAM-1 per CD54 ELISA Kit 96T
UB-C80012 Chicken Intercellular Adhesion Molecule 1,ICAM-1 CD54 ELISA Kit 96T
KN0117Rb Rabbit intercellular adhesion molecule 1,ICAM-1 per CD54 ELISA Kit 96 WELLS
SL0103Rb Rabbit intercellular adhesion molecule 1,ICAM-1 CD54 ELISA Kit 96T
MD-11-0091 Mouse Anti-Human Intercellular Adhesion Molecule-1 (ICAM-1) _ CD54 200
20-321-175250 CD54. INTRACELLULAR ADHESION MOLECULE-1 (ICAM-1) - BIOTINYLATED MONOCLONAL ANTIBODY TO HUMAN CD54. INTRACELLULAR ADHESION MOLECULE-1 (ICAM-1) Monoclonal 0.05 mg
20-321-175249 CD54. INTRACELLULAR ADHESION MOLECULE-1 (ICAM-1) - MONOCLONAL ANTIBODY TO HUMAN CD54. INTRACELLULAR ADHESION MOLECULE-1 (ICAM-1) Monoclonal 0.1 mg
E0048r ELISA kit Icam1,ICAM-1,Icam-1,Intercellular adhesion molecule 1,Rat,Rattus norvegicus 96T
E0048r ELISA Icam1,ICAM-1,Icam-1,Intercellular adhesion molecule 1,Rat,Rattus norvegicus 96T
U0048r CLIA Icam1,ICAM-1,Icam-1,Intercellular adhesion molecule 1,Rat,Rattus norvegicus 96T
E0533h ELISA CDw50,Homo sapiens,Human,ICAM3,ICAM-3,ICAM-R,Intercellular adhesion molecule 3 96T
E0533h ELISA kit CDw50,Homo sapiens,Human,ICAM3,ICAM-3,ICAM-R,Intercellular adhesion molecule 3 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur