Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor class-II member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (Likely interleukin or cytokine receptor 2) (LICR2)

 INLR1_HUMAN             Reviewed;         520 AA.
Q8IU57; Q5VTX5; Q5VTX7; Q5VTX8; Q6ZML8; Q8IV66; Q8IZI7; Q8IZI8;
23-NOV-2004, integrated into UniProtKB/Swiss-Prot.
01-MAR-2003, sequence version 1.
18-JUL-2018, entry version 140.
RecName: Full=Interferon lambda receptor 1;
Short=IFN-lambda receptor 1;
Short=IFN-lambda-R1;
AltName: Full=Cytokine receptor class-II member 12;
AltName: Full=Cytokine receptor family 2 member 12;
Short=CRF2-12;
AltName: Full=Interleukin-28 receptor subunit alpha;
Short=IL-28 receptor subunit alpha;
Short=IL-28R-alpha;
Short=IL-28RA;
AltName: Full=Likely interleukin or cytokine receptor 2;
Short=LICR2;
Flags: Precursor;
Name=IFNLR1; Synonyms=IL28RA, LICR2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4), AND FUNCTION.
PubMed=12521379; DOI=10.1042/BJ20021935;
Dumoutier L., Lejeune D., Hor S., Fickenscher H., Renauld J.-C.;
"Cloning of a new type II cytokine receptor activating signal
transducer and activator of transcription (STAT)1, STAT2 and STAT3.";
Biochem. J. 370:391-396(2003).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), FUNCTION, TISSUE
SPECIFICITY, AND SUBUNIT.
PubMed=12469119; DOI=10.1038/ni873;
Sheppard P., Kindsvogel W., Xu W., Henderson K., Schlutsmeyer S.,
Whitmore T.E., Kuestner R., Garrigues U., Birks C., Roraback J.,
Ostrander C., Dong D., Shin J., Presnell S., Fox B., Haldeman B.,
Cooper E., Taft D., Gilbert T., Grant F.J., Tackett M., Krivan W.,
McKnight G., Clegg C., Foster D., Klucher K.M.;
"IL-28, IL-29 and their class II cytokine receptor IL-28R.";
Nat. Immunol. 4:63-68(2003).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY,
AND SUBUNIT.
PubMed=12483210; DOI=10.1038/ni875;
Kotenko S.V., Gallagher G., Baurin V.V., Lewis-Antes A., Shen M.,
Shah N.K., Langer J.A., Sheikh F., Dickensheets H., Donnelly R.P.;
"IFN-lambdas mediate antiviral protection through a distinct class II
cytokine receptor complex.";
Nat. Immunol. 4:69-77(2003).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Spleen;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
X-RAY CRYSTALLOGRAPHY (2.10 ANGSTROMS) OF 19-226 IN COMPLEX WITH
IFNL1, GLYCOSYLATION AT ASN-29; ASN-36 AND ASN-142, AND DISULFIDE
BONDS.
PubMed=20934432; DOI=10.1016/j.jmb.2010.09.068;
Miknis Z.J., Magracheva E., Li W., Zdanov A., Kotenko S.V.,
Wlodawer A.;
"Crystal structure of human interferon-lambda1 in complex with its
high-affinity receptor interferon-lambdaR1.";
J. Mol. Biol. 404:650-664(2010).
-!- FUNCTION: The IFNLR1/IL10RB dimer is a receptor for the cytokine
ligands IFNL2 and IFNL3 and mediates their antiviral activity. The
ligand/receptor complex stimulate the activation of the JAK/STAT
signaling pathway leading to the expression of IFN-stimulated
genes (ISG), which contribute to the antiviral state. Determines
the cell type specificity of the lambda interferon action. Shows a
more restricted pattern of expression in the epithelial tissues
thereby limiting responses to lambda interferons primarily to
epithelial cells of the respiratory, gastrointestinal, and
reproductive tracts. Seems not to be essential for early virus-
activated host defense in vaginal infection, but plays an
important role in Toll-like receptor (TLR)-induced antiviral
defense. Plays a significant role in the antiviral immune defense
in the intestinal epithelium. {ECO:0000269|PubMed:12469119,
ECO:0000269|PubMed:12483210, ECO:0000269|PubMed:12521379}.
-!- SUBUNIT: Heterodimer with IL10RB. {ECO:0000269|PubMed:12469119,
ECO:0000269|PubMed:12483210, ECO:0000269|PubMed:20934432}.
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000250}; Single-pass type I
membrane protein {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1; Synonyms=IL-28R-alpha-v1;
IsoId=Q8IU57-1; Sequence=Displayed;
Name=2; Synonyms=IL-28R-alpha-v2;
IsoId=Q8IU57-2; Sequence=VSP_011890;
Name=3; Synonyms=IL-28R-alpha-v3;
IsoId=Q8IU57-3; Sequence=VSP_011888, VSP_011889, VSP_011892;
Name=4; Synonyms=Secreted;
IsoId=Q8IU57-4; Sequence=VSP_011891, VSP_011892;
-!- TISSUE SPECIFICITY: Widely expressed.
{ECO:0000269|PubMed:12469119, ECO:0000269|PubMed:12483210}.
-!- SIMILARITY: Belongs to the type II cytokine receptor family.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAD18707.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AJ534330; CAD58829.1; -; mRNA.
EMBL; AJ534331; CAD58830.1; -; mRNA.
EMBL; AY129151; AAN28266.1; -; mRNA.
EMBL; AY129152; AAN28267.1; -; mRNA.
EMBL; AY129153; AAN28268.1; -; mRNA.
EMBL; AF439325; AAN63632.1; -; mRNA.
EMBL; AK160364; BAD18707.1; ALT_INIT; mRNA.
EMBL; AL590683; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471134; EAW95114.1; -; Genomic_DNA.
EMBL; CH471134; EAW95115.1; -; Genomic_DNA.
EMBL; CH471134; EAW95117.1; -; Genomic_DNA.
EMBL; CH471134; EAW95118.1; -; Genomic_DNA.
EMBL; BC140872; AAI40873.1; -; mRNA.
CCDS; CCDS248.1; -. [Q8IU57-1]
CCDS; CCDS249.1; -. [Q8IU57-2]
CCDS; CCDS250.1; -. [Q8IU57-4]
RefSeq; NP_734464.1; NM_170743.3. [Q8IU57-1]
RefSeq; NP_775087.1; NM_173064.2. [Q8IU57-2]
RefSeq; NP_775088.1; NM_173065.2. [Q8IU57-4]
UniGene; Hs.221375; -.
PDB; 3OG4; X-ray; 2.16 A; B=19-226.
PDB; 3OG6; X-ray; 2.10 A; B=19-226.
PDB; 5IXD; X-ray; 2.85 A; B=250-299.
PDB; 5IXI; X-ray; 2.57 A; B=250-259.
PDB; 5L04; X-ray; 2.10 A; B=260-307.
PDB; 5T5W; X-ray; 2.85 A; B=21-226.
PDBsum; 3OG4; -.
PDBsum; 3OG6; -.
PDBsum; 5IXD; -.
PDBsum; 5IXI; -.
PDBsum; 5L04; -.
PDBsum; 5T5W; -.
ProteinModelPortal; Q8IU57; -.
SMR; Q8IU57; -.
BioGrid; 127873; 31.
DIP; DIP-31197N; -.
IntAct; Q8IU57; 4.
STRING; 9606.ENSP00000327824; -.
ChEMBL; CHEMBL3831284; -.
iPTMnet; Q8IU57; -.
PhosphoSitePlus; Q8IU57; -.
BioMuta; IFNLR1; -.
DMDM; 55976528; -.
PaxDb; Q8IU57; -.
PeptideAtlas; Q8IU57; -.
PRIDE; Q8IU57; -.
ProteomicsDB; 70505; -.
ProteomicsDB; 70506; -. [Q8IU57-2]
ProteomicsDB; 70507; -. [Q8IU57-3]
ProteomicsDB; 70508; -. [Q8IU57-4]
Ensembl; ENST00000327535; ENSP00000327824; ENSG00000185436. [Q8IU57-1]
Ensembl; ENST00000327575; ENSP00000328994; ENSG00000185436. [Q8IU57-4]
Ensembl; ENST00000374418; ENSP00000363539; ENSG00000185436. [Q8IU57-3]
Ensembl; ENST00000374421; ENSP00000363542; ENSG00000185436. [Q8IU57-2]
GeneID; 163702; -.
KEGG; hsa:163702; -.
UCSC; uc001bir.4; human. [Q8IU57-1]
CTD; 163702; -.
DisGeNET; 163702; -.
EuPathDB; HostDB:ENSG00000185436.11; -.
GeneCards; IFNLR1; -.
HGNC; HGNC:18584; IFNLR1.
HPA; HPA017319; -.
MIM; 607404; gene.
neXtProt; NX_Q8IU57; -.
OpenTargets; ENSG00000185436; -.
PharmGKB; PA134984880; -.
eggNOG; ENOG410IJDQ; Eukaryota.
eggNOG; ENOG410YYBX; LUCA.
GeneTree; ENSGT00510000048978; -.
HOGENOM; HOG000148579; -.
HOVERGEN; HBG052069; -.
InParanoid; Q8IU57; -.
KO; K05140; -.
OMA; LTFCWDS; -.
OrthoDB; EOG091G0633; -.
PhylomeDB; Q8IU57; -.
TreeFam; TF336003; -.
Reactome; R-HSA-449836; Other interleukin signaling.
Reactome; R-HSA-8854691; Interleukin-20 family signaling.
SignaLink; Q8IU57; -.
SIGNOR; Q8IU57; -.
ChiTaRS; IFNLR1; human.
GeneWiki; Interleukin_28_receptor,_alpha_subunit; -.
GenomeRNAi; 163702; -.
PRO; PR:Q8IU57; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000185436; -.
CleanEx; HS_IL28RA; -.
ExpressionAtlas; Q8IU57; baseline and differential.
Genevisible; Q8IU57; HS.
GO; GO:0016021; C:integral component of membrane; NAS:UniProtKB.
GO; GO:0032002; C:interleukin-28 receptor complex; IDA:UniProtKB.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0004896; F:cytokine receptor activity; IBA:GO_Central.
GO; GO:0019221; P:cytokine-mediated signaling pathway; IBA:GO_Central.
GO; GO:0051607; P:defense response to virus; ISS:UniProtKB.
GO; GO:0002385; P:mucosal immune response; ISS:UniProtKB.
GO; GO:0008285; P:negative regulation of cell proliferation; NAS:UniProtKB.
GO; GO:0050691; P:regulation of defense response to virus by host; IDA:UniProtKB.
GO; GO:0034342; P:response to type III interferon; ISS:UniProtKB.
Gene3D; 2.60.40.10; -; 2.
InterPro; IPR003961; FN3_dom.
InterPro; IPR036116; FN3_sf.
InterPro; IPR013783; Ig-like_fold.
Pfam; PF01108; Tissue_fac; 1.
SUPFAM; SSF49265; SSF49265; 2.
PROSITE; PS50853; FN3; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Antiviral defense;
Complete proteome; Disulfide bond; Glycoprotein; Membrane; Receptor;
Reference proteome; Signal; Transmembrane; Transmembrane helix.
SIGNAL 1 20 {ECO:0000255}.
CHAIN 21 520 Interferon lambda receptor 1.
/FTId=PRO_0000011019.
TOPO_DOM 21 228 Extracellular. {ECO:0000255}.
TRANSMEM 229 249 Helical. {ECO:0000255}.
TOPO_DOM 250 520 Cytoplasmic. {ECO:0000255}.
DOMAIN 26 126 Fibronectin type-III.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
CARBOHYD 29 29 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:20934432}.
CARBOHYD 36 36 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:20934432}.
CARBOHYD 142 142 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:20934432}.
CARBOHYD 169 169 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 74 82 {ECO:0000269|PubMed:20934432}.
DISULFID 86 150 {ECO:0000269|PubMed:20934432}.
DISULFID 195 217 {ECO:0000269|PubMed:20934432}.
VAR_SEQ 171 211 TLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSK
-> VGSSFPAPRLGPLLHPFLLRFFSPSQPAPAPLLQEVFP
VHS (in isoform 3).
{ECO:0000303|PubMed:12469119}.
/FTId=VSP_011888.
VAR_SEQ 212 244 Missing (in isoform 3).
{ECO:0000303|PubMed:12469119}.
/FTId=VSP_011889.
VAR_SEQ 224 244 EANWAFLVLPSLLILLLVIAA -> GLFWTHTPCGNLSAQQ
TRVRE (in isoform 4).
{ECO:0000303|PubMed:12521379}.
/FTId=VSP_011891.
VAR_SEQ 245 520 Missing (in isoform 3 and isoform 4).
{ECO:0000303|PubMed:12469119,
ECO:0000303|PubMed:12521379}.
/FTId=VSP_011892.
VAR_SEQ 268 296 Missing (in isoform 2).
{ECO:0000303|PubMed:12469119}.
/FTId=VSP_011890.
STRAND 28 35 {ECO:0000244|PDB:3OG6}.
STRAND 38 44 {ECO:0000244|PDB:3OG6}.
STRAND 54 60 {ECO:0000244|PDB:3OG6}.
HELIX 63 65 {ECO:0000244|PDB:3OG4}.
STRAND 68 70 {ECO:0000244|PDB:3OG6}.
HELIX 72 74 {ECO:0000244|PDB:3OG6}.
STRAND 75 77 {ECO:0000244|PDB:5T5W}.
STRAND 79 83 {ECO:0000244|PDB:3OG6}.
STRAND 98 104 {ECO:0000244|PDB:3OG6}.
HELIX 119 122 {ECO:0000244|PDB:3OG6}.
STRAND 129 135 {ECO:0000244|PDB:3OG6}.
STRAND 138 144 {ECO:0000244|PDB:3OG6}.
STRAND 156 164 {ECO:0000244|PDB:3OG6}.
STRAND 170 172 {ECO:0000244|PDB:3OG4}.
STRAND 180 185 {ECO:0000244|PDB:3OG6}.
STRAND 192 209 {ECO:0000244|PDB:3OG6}.
STRAND 216 219 {ECO:0000244|PDB:3OG6}.
HELIX 256 258 {ECO:0000244|PDB:5IXI}.
HELIX 265 267 {ECO:0000244|PDB:5L04}.
STRAND 277 279 {ECO:0000244|PDB:5L04}.
STRAND 291 294 {ECO:0000244|PDB:5L04}.
SEQUENCE 520 AA; 57653 MW; CEDAEE57F85D69AC CRC64;
MAGPERWGPL LLCLLQAAPG RPRLAPPQNV TLLSQNFSVY LTWLPGLGNP QDVTYFVAYQ
SSPTRRRWRE VEECAGTKEL LCSMMCLKKQ DLYNKFKGRV RTVSPSSKSP WVESEYLDYL
FEVEPAPPVL VLTQTEEILS ANATYQLPPC MPPLDLKYEV AFWKEGAGNK TLFPVTPHGQ
PVQITLQPAA SEHHCLSART IYTFSVPKYS KFSKPTCFLL EVPEANWAFL VLPSLLILLL
VIAAGGVIWK TLMGNPWFQR AKMPRALDFS GHTHPVATFQ PSRPESVNDL FLCPQKELTR
GVRPTPRVRA PATQQTRWKK DLAEDEEEED EEDTEDGVSF QPYIEPPSFL GQEHQAPGHS
EAGGVDSGRP RAPLVPSEGS SAWDSSDRSW ASTVDSSWDR AGSSGYLAEK GPGQGPGGDG
HQESLPPPEF SKDSGFLEEL PEDNLSSWAT WGTLPPEPNL VPGGPPVSLQ TLTFCWESSP
EEEEEARESE IEDSDAGSWG AESTQRTEDR GRTLGHYMAR


Related products :

Catalog number Product name Quantity
E1425h ELISA kit CRF2-1,Cytokine receptor class-II member 1,Cytokine receptor family 2 member 1,Homo sapiens,Human,IFN-alpha_beta receptor 1,IFNAR,IFNAR1,IFN-R-1,Interferon alpha_beta receptor 1,Type I inte 96T
E1425h ELISA CRF2-1,Cytokine receptor class-II member 1,Cytokine receptor family 2 member 1,Homo sapiens,Human,IFN-alpha_beta receptor 1,IFNAR,IFNAR1,IFN-R-1,Interferon alpha_beta receptor 1,Type I interfero 96T
U1425h CLIA CRF2-1,Cytokine receptor class-II member 1,Cytokine receptor family 2 member 1,Homo sapiens,Human,IFN-alpha_beta receptor 1,IFNAR,IFNAR1,IFN-R-1,Interferon alpha_beta receptor 1,Type I interferon 96T
EIAAB09420 Crlf2,Crlm2,CRLM-2,Cytokine receptor-like factor 2,Cytokine receptor-like molecule 2,Mouse,Mus musculus,Thymic stromal lymphopoietin protein receptor,Tpte2,TSLP receptor,Tslpr,Type I cytokine receptor
orb82616 Human IL29 protein IL28A, IL28B, and IL29, also named interferon lambda2 (IFN lambda 2), IFN lambda 3, and IFN lambda 1, respectively, are newly identified class II cytokine receptor ligands that are 5
IL2RA IL28RA Gene interleukin 28 receptor, alpha (interferon, lambda receptor)
ARP48069_P050 IL28RA(interleukin 28 receptor, alpha (interferon, lambda receptor)) 50 µg
EIAAB09422 CREME9,CREME-9,CRLF3,Cytokine receptor-like factor 3,Cytokine receptor-like molecule 9,Cytokine receptor-related protein 4,CYTOR4,Homo sapiens,Human,P48,Type I cytokine receptor-like factor p48
U0065r CLIA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norvegi 96T
E0065r ELISA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norveg 96T
U0065m CLIA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus muscu 96T
E0065m ELISA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus musc 96T
E0065m ELISA kit CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus 96T
E0065r ELISA kit CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus n 96T
18-661-15120 Interleukin-27 receptor alpha chain - IL-27R-alpha; WSX-1; Type I T-cell cytokine receptor; TCCR; Protein CRL1 Polyclonal 0.1 mg
18-661-15121 Interleukin-27 receptor alpha chain - IL-27R-alpha; WSX-1; Type I T-cell cytokine receptor; TCCR; Protein CRL1 Polyclonal 0.1 mg
EIAAB09419 CRL2,CRLF2,Cytokine receptor-like 2,Cytokine receptor-like factor 2,Homo sapiens,Human,ILXR,IL-XR,Thymic stromal lymphopoietin protein receptor,TSLP receptor,TSLPR
CSB-EL011647MO Mouse interleukin 28 receptor, alpha (interferon, lambda receptor) (IL28RA) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-EL011647HU Human interleukin 28 receptor, alpha (interferon, lambda receptor) (IL28RA) ELISA kit, Species Human, Sample Type serum, plasma 96T
E0065h ELISA kit CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 r 96T
U0065h CLIA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recepto 96T
E0065h ELISA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recept 96T
EIAAB09417 CLF-1,Crlf1,Crlm3,CRLM-3,Cytokine receptor-like factor 1,Cytokine receptor-like molecule 3,Cytokine-like factor 1,Mouse,Mus musculus,Novel cytokine receptor 6,NR6
U1815h CLIA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E1815h ELISA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur