Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Interleukin-1 family member 10 (IL-1F10) (Family of interleukin 1-theta) (FIL1 theta) (Interleukin-1 HY2) (IL-1HY2) (Interleukin-1 theta) (IL-1 theta) (Interleukin-38) (IL-38)

 IL1FA_HUMAN             Reviewed;         152 AA.
Q8WWZ1; Q53SR9; Q56AT8; Q7RTZ5; Q969H5; Q9BYX1;
08-NOV-2002, integrated into UniProtKB/Swiss-Prot.
01-MAR-2002, sequence version 1.
20-JUN-2018, entry version 131.
RecName: Full=Interleukin-1 family member 10;
Short=IL-1F10;
AltName: Full=Family of interleukin 1-theta;
Short=FIL1 theta;
AltName: Full=Interleukin-1 HY2;
Short=IL-1HY2;
AltName: Full=Interleukin-1 theta;
Short=IL-1 theta;
AltName: Full=Interleukin-38;
Short=IL-38;
Name=IL1F10; Synonyms=FIL1T, IL1HY2, IL38;
ORFNames=FKSG75, UNQ6119/PRO20041;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Thymus;
PubMed=11747621; DOI=10.1089/107999001753289505;
Bensen J.T., Dawson P.A., Mychaleckyj J.C., Bowden D.W.;
"Identification of a novel human cytokine gene in the interleukin gene
cluster on chromosome 2q12-14.";
J. Interferon Cytokine Res. 21:899-904(2001).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Wang Y.-G., Li T., Gong L.;
"Identification and characterization of FKSG75, a novel member of the
interleukin-1 family.";
Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), AND VARIANTS
THR-44 AND ASP-51.
TISSUE=Fetal skin;
PubMed=11278614; DOI=10.1074/jbc.M010095200;
Lin H., Ho A.S., Haley-Vicente D., Zhang J., Bernal-Fussell J.,
Pace A.M., Hansen D., Schweighofer K., Mize N.K., Ford J.E.;
"Cloning and characterization of IL1HY2, a novel interleukin-1 family
member.";
J. Biol. Chem. 276:20597-20602(2001).
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=11991722; DOI=10.1006/geno.2002.6751;
Nicklin M.J.H., Barton J.L., Nguyen M., Fitzgerald M.G., Duff W.G.,
Kornman K.;
"A sequence-based map of the nine genes of the human interleukin-1
cluster.";
Genomics 79:718-725(2002).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[6]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS THR-44 AND ASP-51.
SeattleSNPs variation discovery resource;
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA], AND VARIANTS THR-44 AND
ASP-51.
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[9]
FUNCTION.
PubMed=22315422; DOI=10.1073/pnas.1121534109;
van de Veerdonk F.L., Stoeckman A.K., Wu G., Boeckermann A.N.,
Azam T., Netea M.G., Joosten L.A., van der Meer J.W., Hao R.,
Kalabokis V., Dinarello C.A.;
"IL-38 binds to the IL-36 receptor and has biological effects on
immune cells similar to IL-36 receptor antagonist.";
Proc. Natl. Acad. Sci. U.S.A. 109:3001-3005(2012).
[10]
VARIANTS THR-44 AND ASP-51.
PubMed=11991723; DOI=10.1006/geno.2002.6752;
Taylor S.L., Renshaw B.R., Garka K.E., Smith D.E., Sims J.E.;
"Genomic organization of the interleukin-1 locus.";
Genomics 79:726-733(2002).
-!- FUNCTION: Cytokine with immunomodulatory activity. Alone, does not
induce cytokine production, but reduces IL22 and IL17A production
by T-cells in response to heat-killed Candida albicans. Reduces
IL36G-induced production of IL8 by peripheral blood mononuclear
cells. Increases IL6 production by dendritic cells stimulated by
bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2.
{ECO:0000269|PubMed:22315422}.
-!- SUBCELLULAR LOCATION: Secreted.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q8WWZ1-1; Sequence=Displayed;
Name=2;
IsoId=Q8WWZ1-2; Sequence=VSP_002658;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Expressed in fetal skin, spleen and tonsil.
Expressed mostly in the basal epithelia of skin and in
proliferating B-cells of the tonsil.
-!- SIMILARITY: Belongs to the IL-1 family. {ECO:0000305}.
-!- WEB RESOURCE: Name=Wikipedia; Note=Interleukin-1 entry;
URL="https://en.wikipedia.org/wiki/Interleukin_1";
-!- WEB RESOURCE: Name=SeattleSNPs;
URL="http://pga.gs.washington.edu/data/il1f10/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AY029413; AAK33010.1; -; mRNA.
EMBL; AY026753; AAK01948.1; -; mRNA.
EMBL; AF334755; AAK68048.1; -; mRNA.
EMBL; AF334756; AAK68049.1; -; Genomic_DNA.
EMBL; BN000002; CAD29878.1; -; Genomic_DNA.
EMBL; AY358846; AAQ89205.1; -; mRNA.
EMBL; AY972854; AAX59032.1; -; Genomic_DNA.
EMBL; AC016724; AAY14991.1; -; Genomic_DNA.
EMBL; BC103966; AAI03967.1; -; mRNA.
EMBL; BC103967; AAI03968.1; -; mRNA.
EMBL; BC103968; AAI03969.1; -; mRNA.
CCDS; CCDS2112.1; -. [Q8WWZ1-1]
RefSeq; NP_115945.4; NM_032556.5. [Q8WWZ1-1]
RefSeq; NP_775184.1; NM_173161.2. [Q8WWZ1-1]
UniGene; Hs.306974; -.
PDB; 5BOW; X-ray; 1.31 A; A=3-152.
PDBsum; 5BOW; -.
ProteinModelPortal; Q8WWZ1; -.
SMR; Q8WWZ1; -.
BioGrid; 124164; 8.
IntAct; Q8WWZ1; 1.
STRING; 9606.ENSP00000341794; -.
iPTMnet; Q8WWZ1; -.
PhosphoSitePlus; Q8WWZ1; -.
BioMuta; IL1F10; -.
DMDM; 25008589; -.
PaxDb; Q8WWZ1; -.
PeptideAtlas; Q8WWZ1; -.
PRIDE; Q8WWZ1; -.
ProteomicsDB; 74961; -.
ProteomicsDB; 74962; -. [Q8WWZ1-2]
Ensembl; ENST00000341010; ENSP00000341794; ENSG00000136697. [Q8WWZ1-1]
Ensembl; ENST00000393197; ENSP00000376893; ENSG00000136697. [Q8WWZ1-1]
GeneID; 84639; -.
KEGG; hsa:84639; -.
UCSC; uc002tiu.4; human. [Q8WWZ1-1]
CTD; 84639; -.
DisGeNET; 84639; -.
EuPathDB; HostDB:ENSG00000136697.12; -.
GeneCards; IL1F10; -.
HGNC; HGNC:15552; IL1F10.
HPA; HPA059813; -.
MIM; 615296; gene.
neXtProt; NX_Q8WWZ1; -.
OpenTargets; ENSG00000136697; -.
PharmGKB; PA38387; -.
eggNOG; ENOG410IWY5; Eukaryota.
eggNOG; ENOG41118N6; LUCA.
GeneTree; ENSGT00900000141028; -.
HOGENOM; HOG000231506; -.
HOVERGEN; HBG052099; -.
InParanoid; Q8WWZ1; -.
KO; K05488; -.
OMA; PGWFLCG; -.
OrthoDB; EOG091G0PWA; -.
PhylomeDB; Q8WWZ1; -.
TreeFam; TF300203; -.
Reactome; R-HSA-9007892; Interleukin-38 signaling.
Reactome; R-HSA-9014826; Interleukin-36 pathway.
GeneWiki; IL1F10; -.
GenomeRNAi; 84639; -.
PRO; PR:Q8WWZ1; -.
Proteomes; UP000005640; Chromosome 2.
Bgee; ENSG00000136697; -.
CleanEx; HS_IL1F10; -.
Genevisible; Q8WWZ1; HS.
GO; GO:0005576; C:extracellular region; TAS:Reactome.
GO; GO:0005615; C:extracellular space; IBA:GO_Central.
GO; GO:0005125; F:cytokine activity; IBA:GO_Central.
GO; GO:0005149; F:interleukin-1 receptor binding; IBA:GO_Central.
GO; GO:0071345; P:cellular response to cytokine stimulus; TAS:Reactome.
GO; GO:0019221; P:cytokine-mediated signaling pathway; IBA:GO_Central.
GO; GO:0006955; P:immune response; IEA:InterPro.
GO; GO:0006954; P:inflammatory response; IEA:InterPro.
InterPro; IPR027164; IL-1_F10.
InterPro; IPR000975; IL-1_fam.
InterPro; IPR003297; IL-1RA/IL-36.
InterPro; IPR008996; IL1/FGF.
PANTHER; PTHR45416; PTHR45416; 1.
Pfam; PF00340; IL1; 1.
PRINTS; PR00264; INTERLEUKIN1.
PRINTS; PR01360; INTRLEUKIN1X.
SUPFAM; SSF50353; SSF50353; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Complete proteome; Cytokine;
Polymorphism; Reference proteome; Secreted.
CHAIN 1 152 Interleukin-1 family member 10.
/FTId=PRO_0000153650.
VAR_SEQ 9 39 YYIIKYADQKALYTRDGQLLVGDPVADNCCA -> MSSSFL
PEPLPAKSLQHGVPLSLDSSLSSLL (in isoform 2).
{ECO:0000303|Ref.2}.
/FTId=VSP_002658.
VARIANT 44 44 I -> T (in dbSNP:rs6761276).
{ECO:0000269|PubMed:11278614,
ECO:0000269|PubMed:11991723,
ECO:0000269|PubMed:15489334,
ECO:0000269|Ref.6}.
/FTId=VAR_014262.
VARIANT 51 51 A -> D (in dbSNP:rs6743376).
{ECO:0000269|PubMed:11278614,
ECO:0000269|PubMed:11991723,
ECO:0000269|PubMed:15489334,
ECO:0000269|Ref.6}.
/FTId=VAR_014263.
STRAND 8 13 {ECO:0000244|PDB:5BOW}.
HELIX 15 17 {ECO:0000244|PDB:5BOW}.
STRAND 19 23 {ECO:0000244|PDB:5BOW}.
STRAND 26 30 {ECO:0000244|PDB:5BOW}.
HELIX 33 35 {ECO:0000244|PDB:5BOW}.
STRAND 42 46 {ECO:0000244|PDB:5BOW}.
STRAND 56 61 {ECO:0000244|PDB:5BOW}.
TURN 62 65 {ECO:0000244|PDB:5BOW}.
STRAND 66 71 {ECO:0000244|PDB:5BOW}.
STRAND 78 83 {ECO:0000244|PDB:5BOW}.
HELIX 86 90 {ECO:0000244|PDB:5BOW}.
HELIX 94 99 {ECO:0000244|PDB:5BOW}.
STRAND 101 106 {ECO:0000244|PDB:5BOW}.
STRAND 109 114 {ECO:0000244|PDB:5BOW}.
STRAND 120 123 {ECO:0000244|PDB:5BOW}.
STRAND 133 136 {ECO:0000244|PDB:5BOW}.
HELIX 142 144 {ECO:0000244|PDB:5BOW}.
STRAND 146 150 {ECO:0000244|PDB:5BOW}.
SEQUENCE 152 AA; 16943 MW; E0ABD2496551B34F CRC64;
MCSLPMARYY IIKYADQKAL YTRDGQLLVG DPVADNCCAE KICILPNRGL ARTKVPIFLG
IQGGSRCLAC VETEEGPSLQ LEDVNIEELY KGGEEATRFT FFQSSSGSAF RLEAAAWPGW
FLCGPAEPQQ PVQLTKESEP SARTKFYFEQ SW


Related products :

Catalog number Product name Quantity
230-00033-10 Recombinant Human Interleukin-1 family, member 10 (theta) 10
IL1F6 IL1F10 Gene interleukin 1 family, member 10 (theta)
230-00033-50 Recombinant Human Interleukin-1 family, member 10 (theta) 50
230-00033-100 Recombinant Human Interleukin-1 family, member 10 (theta) 100
CSB-EL011615MO Mouse interleukin 1 family, member 10 (theta) (IL1F10) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-EL011615HU Human interleukin 1 family, member 10 (theta) (IL1F10) ELISA kit, Species Human, Sample Type serum, plasma 96T
EIAAB11074 DAG kinase theta,DAGK4,DGKQ,DGK-theta,Diacylglycerol kinase theta,Diglyceride kinase theta,Homo sapiens,Human
EIAAB41768 Cct8,Cctq,CCT-theta,Mouse,Mus musculus,T-complex protein 1 subunit theta,TCP-1-theta
orb82722 Human IL1 RN protein Recombinant Human Interleukin-1 Receptor Antagonist is a member of the Interleukin-1cytokine family. IL1RN inhibits the activities of Interleukin-1 alpha (IL1A) and Interleukin-1 1 mg
EIAAB41767 Bos taurus,Bovine,CCT8,CCT-theta,T-complex protein 1 subunit theta,TCP-1-theta
E2205h Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interleukin-36 ga
E2205h ELISA Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interleukin 96T
U2205h CLIA Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interleukin- 96T
EIAAB41769 C21orf112,CCT8,CCTQ,CCT-theta,Homo sapiens,Human,KIAA0002,Renal carcinoma antigen NY-REN-15,T-complex protein 1 subunit theta,TCP-1-theta
EIAAB11075 DAG kinase theta,Dgkq,DGK-theta,Diacylglycerol kinase theta,Diglyceride kinase theta,Mouse,Mus musculus
E6216h Human Interleukin 1 Theta ELISA Kit 96T
10-663-45567 Protein Kinase C theta (PKC-theta) Human - EC 2.7.11.13; nPKC-theta N_A 0.002 mg
10-663-45567 Protein Kinase C theta (PKC-theta) Human - EC 2.7.11.13; nPKC-theta N_A 1 mg
10-663-45567 Protein Kinase C theta (PKC-theta) Human - EC 2.7.11.13; nPKC-theta N_A 0.01 mg
20-783-71616 RAT ANTI CCT THETA - TCP-1-theta; CCT-theta Monoclonal 0.1 mg
EIAAB41766 CCT8,CCT-theta,Chicken,Gallus gallus,T-complex protein 1 subunit theta,TCP-1-theta
E2205h ELISA kit Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interl 96T
U2205h CLIA kit Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interle 96T
E0065h ELISA kit CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 r 96T
E0066h ELISA kit CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 recepto 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur