Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Interleukin-1 receptor-like 2 (IL-36 receptor) (IL-36R) (Interleukin-1 receptor-related protein 2) (IL-1Rrp2) (IL1R-rp2)

 ILRL2_HUMAN             Reviewed;         575 AA.
Q9HB29; A4FU63; Q13525; Q45H74; Q53TU8; Q587I8;
06-DEC-2002, integrated into UniProtKB/Swiss-Prot.
07-FEB-2006, sequence version 2.
23-MAY-2018, entry version 144.
RecName: Full=Interleukin-1 receptor-like 2;
AltName: Full=IL-36 receptor;
Short=IL-36R;
AltName: Full=Interleukin-1 receptor-related protein 2;
Short=IL-1Rrp2;
Short=IL1R-rp2;
Flags: Precursor;
Name=IL1RL2; Synonyms=IL1RRP2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=10882729; DOI=10.1074/jbc.M004077200;
Born T.L., Smith D.E., Garka K.E., Renshaw B.R., Bertles J.S.,
Sims J.E.;
"Identification and characterization of two members of a novel class
of the interleukin-1 receptor (IL-1R) family. Delineation of a new
class of IL-1R-related proteins based on signaling.";
J. Biol. Chem. 275:29946-29954(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=8898719; DOI=10.1016/S0165-5728(96)00047-1;
Lovenberg T.W., Crowe P.D., Liu C., Chalmers D.T., Liu X.-J., Liaw C.,
Clevenger W., Oltersdorf T., De Souza E.B., Maki R.A.;
"Cloning of a cDNA encoding a novel interleukin-1 receptor related
protein (IL1R-rp2).";
J. Neuroimmunol. 70:113-122(1996).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS ILE-352 AND PRO-550.
SeattleSNPs variation discovery resource;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
FUNCTION AS RECEPTOR FOR IL36G.
PubMed=11466363; DOI=10.4049/jimmunol.167.3.1440;
Debets R., Timans J.C., Homey B., Zurawski S., Sana T.R., Lo S.,
Wagner J., Edwards G., Clifford T., Menon S., Bazan J.F.,
Kastelein R.A.;
"Two novel IL-1 family members, IL-1 delta and IL-1 epsilon, function
as an antagonist and agonist of NF-kappa B activation through the
orphan IL-1 receptor-related protein 2.";
J. Immunol. 167:1440-1446(2001).
[7]
TISSUE SPECIFICITY.
PubMed=16646978; DOI=10.1186/ar1946;
Magne D., Palmer G., Barton J.L., Mezin F., Talabot-Ayer D., Bas S.,
Duffy T., Noger M., Guerne P.A., Nicklin M.J., Gabay C.;
"The new IL-1 family member IL-1F8 stimulates production of
inflammatory mediators by synovial fibroblasts and articular
chondrocytes.";
Arthritis Res. Ther. 8:R80-R80(2006).
[8]
TISSUE SPECIFICITY, AND SUBCELLULAR LOCATION.
PubMed=24829417; DOI=10.4049/jimmunol.1301481;
Foster A.M., Baliwag J., Chen C.S., Guzman A.M., Stoll S.W.,
Gudjonsson J.E., Ward N.L., Johnston A.;
"IL-36 promotes myeloid cell infiltration, activation, and
inflammatory activity in skin.";
J. Immunol. 192:6053-6061(2014).
-!- FUNCTION: Receptor for interleukin-36 (IL36A, IL36B and IL36G).
After binding to interleukin-36 associates with the coreceptor
IL1RAP to form the interleukin-36 receptor complex which mediates
interleukin-36-dependent activation of NF-kappa-B, MAPK and other
pathways (By similarity). The IL-36 signaling system is thought to
be present in epithelial barriers and to take part in local
inflammatory response; it is similar to the IL-1 system. Seems to
be involved in skin inflammatory response by induction of the IL-
23/IL-17/IL-22 pathway. {ECO:0000250|UniProtKB:Q9ERS7,
ECO:0000269|PubMed:11466363}.
-!- SUBUNIT: Interacts with IL1RAP; the association is enhanced by
IL36B indicative for an functional signaling complex and inhibited
by IL36RN (By similarity). {ECO:0000250|UniProtKB:Q9ERS7}.
-!- SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane
protein {ECO:0000269|PubMed:24829417}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q9HB29-1; Sequence=Displayed;
Name=2;
IsoId=Q9HB29-2; Sequence=VSP_056292, VSP_056293, VSP_056294;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Expressed in synovial fibroblasts and
articular chondrocytes. Expressed in keratinocytes and monocyte-
derived dendritic cells. Expressed in monocytes and myeloid
dendritic cells; at protein level. {ECO:0000269|PubMed:16646978,
ECO:0000269|PubMed:24829417}.
-!- SIMILARITY: Belongs to the interleukin-1 receptor family.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAB53237.1; Type=Frameshift; Positions=556; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=SeattleSNPs;
URL="http://pga.gs.washington.edu/data/il1rl2/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF284434; AAG21368.1; -; mRNA.
EMBL; U49065; AAB53237.1; ALT_FRAME; mRNA.
EMBL; DQ131903; AAZ38712.1; -; Genomic_DNA.
EMBL; AC007271; AAX81989.1; -; Genomic_DNA.
EMBL; AC007248; AAY15046.1; -; Genomic_DNA.
EMBL; BC107064; AAI07065.1; -; mRNA.
CCDS; CCDS2056.1; -. [Q9HB29-1]
PIR; G02426; G02426.
RefSeq; NP_003845.2; NM_003854.2. [Q9HB29-1]
RefSeq; XP_005264093.1; XM_005264036.1.
UniGene; Hs.659863; -.
ProteinModelPortal; Q9HB29; -.
SMR; Q9HB29; -.
BioGrid; 114336; 11.
STRING; 9606.ENSP00000264257; -.
GuidetoPHARMACOLOGY; 1736; -.
iPTMnet; Q9HB29; -.
PhosphoSitePlus; Q9HB29; -.
BioMuta; IL1RL2; -.
DMDM; 90110768; -.
PaxDb; Q9HB29; -.
PeptideAtlas; Q9HB29; -.
PRIDE; Q9HB29; -.
Ensembl; ENST00000264257; ENSP00000264257; ENSG00000115598. [Q9HB29-1]
Ensembl; ENST00000441515; ENSP00000413348; ENSG00000115598. [Q9HB29-2]
GeneID; 8808; -.
KEGG; hsa:8808; -.
UCSC; uc002tbs.4; human. [Q9HB29-1]
CTD; 8808; -.
DisGeNET; 8808; -.
EuPathDB; HostDB:ENSG00000115598.9; -.
GeneCards; IL1RL2; -.
H-InvDB; HIX0029839; -.
HGNC; HGNC:5999; IL1RL2.
HPA; HPA015485; -.
MIM; 604512; gene.
neXtProt; NX_Q9HB29; -.
OpenTargets; ENSG00000115598; -.
PharmGKB; PA29815; -.
eggNOG; ENOG410IQBC; Eukaryota.
eggNOG; ENOG410Z3W1; LUCA.
GeneTree; ENSGT00760000119071; -.
HOGENOM; HOG000253916; -.
HOVERGEN; HBG052103; -.
InParanoid; Q9HB29; -.
KO; K05172; -.
OMA; DNTNLRC; -.
OrthoDB; EOG091G03IT; -.
PhylomeDB; Q9HB29; -.
TreeFam; TF325519; -.
Reactome; R-HSA-9007892; Interleukin-38 signaling.
Reactome; R-HSA-9014826; Interleukin-36 pathway.
ChiTaRS; IL1RL2; human.
GeneWiki; IL1RL2; -.
GenomeRNAi; 8808; -.
PRO; PR:Q9HB29; -.
Proteomes; UP000005640; Chromosome 2.
Bgee; ENSG00000115598; -.
CleanEx; HS_IL1RL2; -.
ExpressionAtlas; Q9HB29; baseline and differential.
Genevisible; Q9HB29; HS.
GO; GO:0005887; C:integral component of plasma membrane; TAS:ProtInc.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0004908; F:interleukin-1 receptor activity; TAS:ProtInc.
GO; GO:0004909; F:interleukin-1, Type I, activating receptor activity; IEA:InterPro.
GO; GO:0006968; P:cellular defense response; TAS:ProtInc.
GO; GO:0071345; P:cellular response to cytokine stimulus; TAS:Reactome.
GO; GO:0019221; P:cytokine-mediated signaling pathway; TAS:Reactome.
GO; GO:0006954; P:inflammatory response; IEA:UniProtKB-KW.
GO; GO:0045087; P:innate immune response; IEA:UniProtKB-KW.
GO; GO:0032755; P:positive regulation of interleukin-6 production; IEA:Ensembl.
GO; GO:0045582; P:positive regulation of T cell differentiation; IEA:Ensembl.
GO; GO:0050727; P:regulation of inflammatory response; IEA:Ensembl.
GO; GO:0007165; P:signal transduction; TAS:ProtInc.
Gene3D; 2.60.40.10; -; 3.
Gene3D; 3.40.50.10140; -; 1.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003599; Ig_sub.
InterPro; IPR015621; IL-1_rcpt_fam.
InterPro; IPR004076; IL-1_rcpt_I-typ.
InterPro; IPR004074; IL-1_rcpt_I/II-typ.
InterPro; IPR000157; TIR_dom.
InterPro; IPR035897; Toll_tir_struct_dom_sf.
PANTHER; PTHR11890; PTHR11890; 1.
Pfam; PF13895; Ig_2; 2.
Pfam; PF01582; TIR; 1.
PRINTS; PR01538; INTRLEUKN1R1.
PRINTS; PR01536; INTRLKN1R12F.
SMART; SM00409; IG; 3.
SMART; SM00255; TIR; 1.
SUPFAM; SSF48726; SSF48726; 3.
SUPFAM; SSF52200; SSF52200; 1.
PROSITE; PS50835; IG_LIKE; 2.
PROSITE; PS50104; TIR; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Disulfide bond; Glycoprotein;
Immunity; Immunoglobulin domain; Inflammatory response;
Innate immunity; Membrane; Polymorphism; Receptor; Reference proteome;
Repeat; Signal; Transmembrane; Transmembrane helix.
SIGNAL 1 19 {ECO:0000255}.
CHAIN 20 575 Interleukin-1 receptor-like 2.
/FTId=PRO_0000015445.
TOPO_DOM 20 335 Extracellular. {ECO:0000255}.
TRANSMEM 336 356 Helical. {ECO:0000255}.
TOPO_DOM 357 575 Cytoplasmic. {ECO:0000255}.
DOMAIN 20 111 Ig-like C2-type 1.
DOMAIN 126 211 Ig-like C2-type 2.
DOMAIN 222 318 Ig-like C2-type 3.
DOMAIN 381 539 TIR. {ECO:0000255|PROSITE-
ProRule:PRU00204}.
CARBOHYD 41 41 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 59 59 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 109 109 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 127 127 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 184 184 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 234 234 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 250 250 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 266 266 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 299 299 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 42 95 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 146 195 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 249 316 {ECO:0000255|PROSITE-ProRule:PRU00114}.
VAR_SEQ 1 46 MWSLLLCGLSIALPLSVTADGCKDIFMKNEILSASQPFAFN
CTFPP -> MTGLVSLSYFPLSTRSCALQSCSPVWGCGPCC
SAGCPSPFHCLSQQ (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_056292.
VAR_SEQ 47 163 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_056293.
VAR_SEQ 217 218 TE -> K (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_056294.
VARIANT 237 237 I -> T (in dbSNP:rs13405631).
/FTId=VAR_053378.
VARIANT 352 352 V -> I (in dbSNP:rs33946385).
{ECO:0000269|Ref.3}.
/FTId=VAR_025259.
VARIANT 550 550 L -> P (in dbSNP:rs2302612).
{ECO:0000269|Ref.3}.
/FTId=VAR_025260.
CONFLICT 486 486 I -> V (in Ref. 1; AAG21368).
{ECO:0000305}.
CONFLICT 545 556 PPVQLLQHTPCY -> LRSTCRSTHLCTA (in Ref.
2). {ECO:0000305}.
CONFLICT 556 556 Y -> C (in Ref. 1; AAG21368).
{ECO:0000305}.
SEQUENCE 575 AA; 65405 MW; 7AC0FCAB43A2A6CD CRC64;
MWSLLLCGLS IALPLSVTAD GCKDIFMKNE ILSASQPFAF NCTFPPITSG EVSVTWYKNS
SKIPVSKIIQ SRIHQDETWI LFLPMEWGDS GVYQCVIKGR DSCHRIHVNL TVFEKHWCDT
SIGGLPNLSD EYKQILHLGK DDSLTCHLHF PKSCVLGPIK WYKDCNEIKG ERFTVLETRL
LVSNVSAEDR GNYACQAILT HSGKQYEVLN GITVSITERA GYGGSVPKII YPKNHSIEVQ
LGTTLIVDCN VTDTKDNTNL RCWRVNNTLV DDYYDESKRI REGVETHVSF REHNLYTVNI
TFLEVKMEDY GLPFMCHAGV STAYIILQLP APDFRAYLIG GLIALVAVAV SVVYIYNIFK
IDIVLWYRSA FHSTETIVDG KLYDAYVLYP KPHKESQRHA VDALVLNILP EVLERQCGYK
LFIFGRDEFP GQAVANVIDE NVKLCRRLIV IVVPESLGFG LLKNLSEEQI AVYSALIQDG
MKVILIELEK IEDYTVMPES IQYIKQKHGA IRWHGDFTEQ SQCMKTKFWK TVRYHMPPRR
CRPFPPVQLL QHTPCYRTAG PELGSRRKKC TLTTG


Related products :

Catalog number Product name Quantity
E0065h ELISA kit CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 r 96T
E0065h ELISA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recept 96T
U0065h CLIA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recepto 96T
26-207 IL1RAPL2 is a member of the interleukin 1 receptor family. This protein is similar to the interleukin 1 accessory proteins, and is most closely related to interleukin 1 receptor accessory protein-like 0.05 mg
orb82731 Human IL4 protein Interleukin-4 (IL4) is a pleiotropic cytokine produced by activated T cells. IL4 is a ligandfor interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which maycontri 1 mg
E0066h ELISA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor typ 96T
EIAAB38456 Homo sapiens,Human,SIGIRR,Single Ig IL-1-related receptor,Single Ig IL-1R-related molecule,Single immunoglobulin domain-containing IL1R-related protein,TIR8,Toll_interleukin-1 receptor 8,UNQ301_PRO342
EIAAB38457 Rat,Rattus norvegicus,Sigirr,Single Ig IL-1-related receptor,Single Ig IL-1R-related molecule,Single immunoglobulin domain-containing IL1R-related protein,TIR8,Toll_interleukin-1 receptor 8
18-661-15202 Single Ig IL-1-related receptor - Single Ig IL-1R-related molecule; Single immunoglobulin domain-containing IL1R-related protein; Toll_interleukin-1 receptor 8; TIR8 Polyclonal 0.1 mg
U0066h CLIA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type 96T
E0066m ELISA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus muscu 96T
E0066r ELISA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Rat,Rattus norv 96T
U0066r CLIA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Rat,Rattus norve 96T
E0065r ELISA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norveg 96T
U0065m CLIA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus muscu 96T
E0065m ELISA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus musc 96T
U0065r CLIA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norvegi 96T
U0066m CLIA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus muscul 96T
E0066r ELISA kit CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Rat,Rattus 96T
E0065r ELISA kit CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus n 96T
E0065m ELISA kit CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus 96T
E0066m ELISA kit CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus 96T
EIAAB38458 Mouse,Mus musculus,Sigirr,Single Ig IL-1-related receptor,Single Ig IL-1R-related molecule,Single immunoglobulin domain-containing IL1R-related protein,TIR8,Tir8,Toll_interleukin-1 receptor 8
30-047 IL10RA is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits th 0.1 mg
103-M136 IL-1 R1 Anti-Mouse Host: Rat Il1r1; IL-iR; CD121a; CD121b; Il1r-1; Interleukin 1 receptor 1 100


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur