Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Interleukin-12 receptor subunit beta-1 (IL-12 receptor subunit beta-1) (IL-12R subunit beta-1) (IL-12R-beta-1) (IL-12RB1) (IL-12 receptor beta component) (CD antigen CD212)

 I12R1_HUMAN             Reviewed;         662 AA.
P42701; A8K308; B2RPF1; B7ZKK3; Q8N6Q7;
01-NOV-1995, integrated into UniProtKB/Swiss-Prot.
01-NOV-1995, sequence version 1.
25-OCT-2017, entry version 175.
RecName: Full=Interleukin-12 receptor subunit beta-1;
Short=IL-12 receptor subunit beta-1;
Short=IL-12R subunit beta-1;
Short=IL-12R-beta-1;
Short=IL-12RB1;
AltName: Full=IL-12 receptor beta component;
AltName: CD_antigen=CD212;
Flags: Precursor;
Name=IL12RB1; Synonyms=IL12R, IL12RB;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
PubMed=7911493;
Chua A.O., Chizzonite R., Desai B.B., Truitt T.P., Nunes P.,
Minetti L.J., Warrier R.R., Presky D.H., Levine J.F., Gately M.K.,
Gubler U.;
"Expression cloning of a human IL-12 receptor component. A new member
of the cytokine receptor superfamily with strong homology to gp130.";
J. Immunol. 153:128-136(1994).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Elloumi-Zghal H., Abdelhak S., Dellagi K.;
"Genomic structure of IL12RB1 gene.";
Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS GLN-3; SER-47;
HIS-156; ARG-214; GLN-339; THR-365 AND ARG-378.
SeattleSNPs variation discovery resource;
Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
TISSUE=Umbilical cord blood;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15057824; DOI=10.1038/nature02399;
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J.,
Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M.,
Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E.,
Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M.,
Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C.,
Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M.,
Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T.,
Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H.,
Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S.,
Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J.,
Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M.,
Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J.,
Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D.,
Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A.,
Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I.,
Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E.,
Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M.,
Rubin E.M., Lucas S.M.;
"The DNA sequence and biology of human chromosome 19.";
Nature 428:529-535(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), AND
VARIANT ARG-214.
TISSUE=Colon, and Testis;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
SUBUNIT.
PubMed=8943050; DOI=10.1073/pnas.93.24.14002;
Presky D.H., Yang H., Minetti L.J., Chua A.O., Nabavi N., Wu C.-Y.,
Gately M.K., Gubler U.;
"A functional interleukin 12 receptor complex is composed of two beta-
type cytokine receptor subunits.";
Proc. Natl. Acad. Sci. U.S.A. 93:14002-14007(1996).
[9]
FUNCTION, AND INTERACTION WITH IL23R.
PubMed=12023369; DOI=10.4049/jimmunol.168.11.5699;
Parham C., Chirica M., Timans J., Vaisberg E., Travis M., Cheung J.,
Pflanz S., Zhang R., Singh K.P., Vega F., To W., Wagner J.,
O'Farrell A.-M., McClanahan T.K., Zurawski S., Hannum C., Gorman D.,
Rennick D.M., Kastelein R.A., de Waal Malefyt R., Moore K.W.;
"A receptor for the heterodimeric cytokine IL-23 is composed of IL-
12Rbeta1 and a novel cytokine receptor subunit, IL-23R.";
J. Immunol. 168:5699-5708(2002).
[10]
VARIANT IMD30 TRP-213.
PubMed=11424023; DOI=10.1086/321999;
Altare F., Ensser A., Breiman A., Reichenbach J., El Baghdadi J.,
Fischer A., Emile J.-F., Gaillard J.-L., Meinl E., Casanova J.-L.;
"Interleukin-12 receptor beta-1 deficiency in a patient with abdominal
tuberculosis.";
J. Infect. Dis. 184:231-236(2001).
-!- FUNCTION: Functions as an interleukin receptor which binds
interleukin-12 with low affinity and is involved in IL12
transduction. Associated with IL12RB2 it forms a functional, high
affinity receptor for IL12. Associates also with IL23R to form the
interleukin-23 receptor which functions in IL23 signal
transduction probably through activation of the Jak-Stat signaling
cascade. {ECO:0000269|PubMed:12023369}.
-!- SUBUNIT: Dimer or oligomer; disulfide-linked. Interacts with
IL12RB2 to form the high affinity IL12 receptor. Heterodimer with
IL23R; in presence of IL23. The heterodimer forms the IL23
receptor. {ECO:0000269|PubMed:12023369,
ECO:0000269|PubMed:8943050}.
-!- SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane
protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1; Synonyms=Long;
IsoId=P42701-1; Sequence=Displayed;
Name=2; Synonyms=Short;
IsoId=P42701-2; Sequence=VSP_001715;
Name=3;
IsoId=P42701-3; Sequence=VSP_037043, VSP_037044;
-!- DOMAIN: The WSXWS motif appears to be necessary for proper protein
folding and thereby efficient intracellular transport and cell-
surface receptor binding.
-!- DOMAIN: The box 1 motif is required for JAK interaction and/or
activation.
-!- DISEASE: Immunodeficiency 30 (IMD30) [MIM:614891]: A form of
Mendelian susceptibility to mycobacterial disease, a rare
condition caused by impairment of interferon-gamma mediated
immunity. It is characterized by predisposition to illness caused
by moderately virulent mycobacterial species, such as Bacillus
Calmette-Guerin (BCG) vaccine, environmental non-tuberculous
mycobacteria, and by the more virulent Mycobacterium tuberculosis.
Other microorganisms rarely cause severe clinical disease in
individuals with susceptibility to mycobacterial infections, with
the exception of Salmonella which infects less than 50% of these
individuals. Clinical outcome severity depends on the degree of
impairment of interferon-gamma mediated immunity. Some patients
die of overwhelming mycobacterial disease with lepromatous-like
lesions in early childhood, whereas others develop, later in life,
disseminated but curable infections with tuberculoid granulomas.
IMD30 has low penetrance, and affected individuals have relatively
mild disease and good prognosis. BCG disease and salmonellosis are
the most frequent infections in IMD30 patients.
{ECO:0000269|PubMed:11424023}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- SIMILARITY: Belongs to the type I cytokine receptor family. Type 2
subfamily. {ECO:0000305}.
-!- WEB RESOURCE: Name=IL12RB1base; Note=IL12RB1 mutation db;
URL="http://structure.bmc.lu.se/idbase/IL12RB1base/";
-!- WEB RESOURCE: Name=SeattleSNPs;
URL="http://pga.gs.washington.edu/data/il12rb1/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; U03187; AAA21340.1; -; mRNA.
EMBL; AJ297688; CAC10446.1; -; Genomic_DNA.
EMBL; AJ297689; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297690; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297691; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297692; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297693; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297694; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297695; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297696; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297697; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297698; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297699; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297700; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297701; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AY771996; AAV28734.1; -; Genomic_DNA.
EMBL; AK290423; BAF83112.1; -; mRNA.
EMBL; AC020904; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471106; EAW84656.1; -; Genomic_DNA.
EMBL; BC029121; AAH29121.1; -; mRNA.
EMBL; BC137404; AAI37405.1; -; mRNA.
EMBL; BC137406; AAI37407.1; -; mRNA.
CCDS; CCDS32957.1; -. [P42701-3]
CCDS; CCDS54232.1; -. [P42701-1]
PIR; I37892; I37892.
RefSeq; NP_001276952.1; NM_001290023.1. [P42701-2]
RefSeq; NP_005526.1; NM_005535.2. [P42701-1]
RefSeq; NP_714912.1; NM_153701.2. [P42701-3]
UniGene; Hs.567294; -.
ProteinModelPortal; P42701; -.
BioGrid; 109808; 18.
CORUM; P42701; -.
DIP; DIP-3773N; -.
IntAct; P42701; 5.
STRING; 9606.ENSP00000403103; -.
iPTMnet; P42701; -.
PhosphoSitePlus; P42701; -.
BioMuta; IL12RB1; -.
DMDM; 1170462; -.
MaxQB; P42701; -.
PaxDb; P42701; -.
PeptideAtlas; P42701; -.
PRIDE; P42701; -.
DNASU; 3594; -.
Ensembl; ENST00000322153; ENSP00000314425; ENSG00000096996. [P42701-3]
Ensembl; ENST00000593993; ENSP00000472165; ENSG00000096996. [P42701-1]
Ensembl; ENST00000600835; ENSP00000470788; ENSG00000096996. [P42701-1]
GeneID; 3594; -.
KEGG; hsa:3594; -.
UCSC; uc002nhw.2; human. [P42701-1]
CTD; 3594; -.
DisGeNET; 3594; -.
EuPathDB; HostDB:ENSG00000096996.15; -.
GeneCards; IL12RB1; -.
HGNC; HGNC:5971; IL12RB1.
HPA; HPA074414; -.
MalaCards; IL12RB1; -.
MIM; 601604; gene.
MIM; 614891; phenotype.
neXtProt; NX_P42701; -.
OpenTargets; ENSG00000096996; -.
Orphanet; 319552; Mendelian susceptibility to mycobacterial diseases due to complete IL12RB1 deficiency.
Orphanet; 186; Primary biliary cirrhosis.
PharmGKB; PA29786; -.
eggNOG; ENOG410IJY4; Eukaryota.
eggNOG; ENOG410YV8S; LUCA.
GeneTree; ENSGT00390000012431; -.
HOGENOM; HOG000082476; -.
HOVERGEN; HBG052058; -.
InParanoid; P42701; -.
KO; K05063; -.
OMA; KEYVVRC; -.
OrthoDB; EOG091G052Z; -.
PhylomeDB; P42701; -.
TreeFam; TF338613; -.
Reactome; R-HSA-447115; Interleukin-12 family signaling.
SignaLink; P42701; -.
SIGNOR; P42701; -.
GeneWiki; Interleukin_12_receptor,_beta_1_subunit; -.
GenomeRNAi; 3594; -.
PRO; PR:P42701; -.
Proteomes; UP000005640; Chromosome 19.
Bgee; ENSG00000096996; -.
CleanEx; HS_IL12RB1; -.
ExpressionAtlas; P42701; baseline and differential.
Genevisible; P42701; HS.
GO; GO:0009897; C:external side of plasma membrane; IEA:Ensembl.
GO; GO:0042022; C:interleukin-12 receptor complex; IDA:BHF-UCL.
GO; GO:0072536; C:interleukin-23 receptor complex; IDA:BHF-UCL.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0019955; F:cytokine binding; IEA:Ensembl.
GO; GO:0004896; F:cytokine receptor activity; TAS:UniProtKB.
GO; GO:0071346; P:cellular response to interferon-gamma; IDA:BHF-UCL.
GO; GO:0019221; P:cytokine-mediated signaling pathway; TAS:BHF-UCL.
GO; GO:0035722; P:interleukin-12-mediated signaling pathway; TAS:Reactome.
GO; GO:0038155; P:interleukin-23-mediated signaling pathway; IEA:GOC.
GO; GO:0018108; P:peptidyl-tyrosine phosphorylation; IEA:Ensembl.
GO; GO:0042104; P:positive regulation of activated T cell proliferation; IDA:BHF-UCL.
GO; GO:0002230; P:positive regulation of defense response to virus by host; IDA:BHF-UCL.
GO; GO:0032729; P:positive regulation of interferon-gamma production; IDA:BHF-UCL.
GO; GO:0043382; P:positive regulation of memory T cell differentiation; ISS:BHF-UCL.
GO; GO:0001916; P:positive regulation of T cell mediated cytotoxicity; ISS:BHF-UCL.
GO; GO:0002827; P:positive regulation of T-helper 1 type immune response; IDA:BHF-UCL.
GO; GO:2000330; P:positive regulation of T-helper 17 cell lineage commitment; ISS:BHF-UCL.
GO; GO:2000318; P:positive regulation of T-helper 17 type immune response; ISS:BHF-UCL.
GO; GO:0007165; P:signal transduction; IC:BHF-UCL.
CDD; cd00063; FN3; 1.
Gene3D; 2.60.40.10; -; 2.
InterPro; IPR003961; FN3_dom.
InterPro; IPR036116; FN3_sf.
InterPro; IPR003529; Hematopoietin_rcpt_Gp130_CS.
InterPro; IPR013783; Ig-like_fold.
Pfam; PF00041; fn3; 1.
SMART; SM00060; FN3; 1.
SUPFAM; SSF49265; SSF49265; 1.
PROSITE; PS50853; FN3; 3.
PROSITE; PS01353; HEMATOPO_REC_L_F2; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Disease mutation;
Disulfide bond; Glycoprotein; Membrane; Polymorphism; Receptor;
Reference proteome; Repeat; Signal; Transmembrane;
Transmembrane helix.
SIGNAL 1 23 {ECO:0000255}.
CHAIN 24 662 Interleukin-12 receptor subunit beta-1.
/FTId=PRO_0000010917.
TOPO_DOM 24 545 Extracellular. {ECO:0000255}.
TRANSMEM 546 570 Helical. {ECO:0000255}.
TOPO_DOM 571 662 Cytoplasmic. {ECO:0000255}.
DOMAIN 46 136 Fibronectin type-III 1.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 142 234 Fibronectin type-III 2.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 237 337 Fibronectin type-III 3.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 338 444 Fibronectin type-III 4.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 448 542 Fibronectin type-III 5.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
MOTIF 222 226 WSXWS motif.
MOTIF 577 585 Box 1 motif.
CARBOHYD 121 121 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 329 329 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 346 346 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 352 352 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 442 442 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 456 456 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 52 62 {ECO:0000250}.
VAR_SEQ 341 422 EPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLA
TCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASA
-> DGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLI
LYF (in isoform 3).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_037043.
VAR_SEQ 423 662 Missing (in isoform 3).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_037044.
VAR_SEQ 659 662 KAKM -> DR (in isoform 2).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:7911493}.
/FTId=VSP_001715.
VARIANT 3 3 P -> Q (in dbSNP:rs17884651).
{ECO:0000269|Ref.3}.
/FTId=VAR_021281.
VARIANT 47 47 P -> S (in dbSNP:rs17887176).
{ECO:0000269|Ref.3}.
/FTId=VAR_021282.
VARIANT 156 156 R -> H (in dbSNP:rs11575926).
{ECO:0000269|Ref.3}.
/FTId=VAR_021283.
VARIANT 213 213 R -> W (in IMD30; dbSNP:rs121434494).
{ECO:0000269|PubMed:11424023}.
/FTId=VAR_015577.
VARIANT 214 214 Q -> R (in dbSNP:rs11575934).
{ECO:0000269|PubMed:15489334,
ECO:0000269|Ref.3}.
/FTId=VAR_021284.
VARIANT 339 339 H -> Q (in dbSNP:rs17884957).
{ECO:0000269|Ref.3}.
/FTId=VAR_021285.
VARIANT 365 365 M -> T (in dbSNP:rs375947).
{ECO:0000269|Ref.3}.
/FTId=VAR_011986.
VARIANT 378 378 G -> R (in dbSNP:rs401502).
{ECO:0000269|Ref.3}.
/FTId=VAR_011987.
SEQUENCE 662 AA; 73109 MW; 541ADA60F62DA1EF CRC64;
MEPLVTWVVP LLFLFLLSRQ GAACRTSECC FQDPPYPDAD SGSASGPRDL RCYRISSDRY
ECSWQYEGPT AGVSHFLRCC LSSGRCCYFA AGSATRLQFS DQAGVSVLYT VTLWVESWAR
NQTEKSPEVT LQLYNSVKYE PPLGDIKVSK LAGQLRMEWE TPDNQVGAEV QFRHRTPSSP
WKLGDCGPQD DDTESCLCPL EMNVAQEFQL RRRQLGSQGS SWSKWSSPVC VPPENPPQPQ
VRFSVEQLGQ DGRRRLTLKE QPTQLELPEG CQGLAPGTEV TYRLQLHMLS CPCKAKATRT
LHLGKMPYLS GAAYNVAVIS SNQFGPGLNQ TWHIPADTHT EPVALNISVG TNGTTMYWPA
RAQSMTYCIE WQPVGQDGGL ATCSLTAPQD PDPAGMATYS WSRESGAMGQ EKCYYITIFA
SAHPEKLTLW STVLSTYHFG GNASAAGTPH HVSVKNHSLD SVSVDWAPSL LSTCPGVLKE
YVVRCRDEDS KQVSEHPVQP TETQVTLSGL RAGVAYTVQV RADTAWLRGV WSQPQRFSIE
VQVSDWLIFF ASLGSFLSIL LVGVLGYLGL NRAARHLCPP LPTPCASSAI EFPGGKETWQ
WINPVDFQEE ASLQEALVVE MSWDKGERTE PLEKTELPEG APELALDTEL SLEDGDRCKA
KM


Related products :

Catalog number Product name Quantity
E1761h ELISA kit Homo sapiens,Human,IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Oncostatin-M-specific receptor subunit beta,OSMR,OSMRB 96T
E1761h ELISA Homo sapiens,Human,IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Oncostatin-M-specific receptor subunit beta,OSMR,OSMRB 96T
U1761h CLIA Homo sapiens,Human,IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Oncostatin-M-specific receptor subunit beta,OSMR,OSMRB 96T
U1761r CLIA IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Oncostatin-M-specific receptor subunit beta,Osmr,Osmrb,Rat,Rattus norvegicus 96T
E1761r ELISA IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Oncostatin-M-specific receptor subunit beta,Osmr,Osmrb,Rat,Rattus norvegicus 96T
E1761r ELISA kit IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Oncostatin-M-specific receptor subunit beta,Osmr,Osmrb,Rat,Rattus norvegicus 96T
U1761m CLIA IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Mouse,Mus musculus,Oncostatin-M-specific receptor subunit beta,Osmr,Osmrb 96T
E1761m ELISA IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Mouse,Mus musculus,Oncostatin-M-specific receptor subunit beta,Osmr,Osmrb 96T
E1761m ELISA kit IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Mouse,Mus musculus,Oncostatin-M-specific receptor subunit beta,Osmr,Osmrb 96T
E1837h ELISA kit High affinity IL-2 receptor subunit beta,Homo sapiens,Human,IL-2 receptor subunit beta,IL-2R subunit beta,IL2RB,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,p75 96T
U1837h CLIA High affinity IL-2 receptor subunit beta,Homo sapiens,Human,IL-2 receptor subunit beta,IL-2R subunit beta,IL2RB,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,p75 96T
E1837h ELISA High affinity IL-2 receptor subunit beta,Homo sapiens,Human,IL-2 receptor subunit beta,IL-2R subunit beta,IL2RB,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,p75 96T
U1837h CLIA kit High affinity IL-2 receptor subunit beta,Homo sapiens,Human,IL-2 receptor subunit beta,IL-2R subunit beta,IL2RB,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,p75 96T
U1837m CLIA High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,Mouse,Mus musculus,p70-75 96T
E1837m ELISA kit High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,Mouse,Mus musculus,p70-75 96T
U1837r CLIA High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,Rat,Rattus norvegicus 96T
E1837m ELISA High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,Mouse,Mus musculus,p70-75 96T
U1837r CLIA kit High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,Rat,Rattus norvegicus 96T
E1837r ELISA High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,Rat,Rattus norvegicus 96T
E1837r ELISA kit High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,Rat,Rattus norvegicus 96T
U1837m CLIA kit High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,Mouse,Mus musculus,p70-75 96T
U0046r CLIA gp130,IL-6 receptor subunit beta,IL-6R subunit beta,IL-6RB,IL-6R-beta,Il6st,Interleukin-6 receptor subunit beta,Interleukin-6 signal transducer,Membrane glycoprotein 130,Oncostatin-M receptor sub 96T
E0046r ELISA gp130,IL-6 receptor subunit beta,IL-6R subunit beta,IL-6RB,IL-6R-beta,Il6st,Interleukin-6 receptor subunit beta,Interleukin-6 signal transducer,Membrane glycoprotein 130,Oncostatin-M receptor su 96T
E0046h ELISA kit CDw130,gp130,Homo sapiens,Human,IL-6 receptor subunit beta,IL-6R subunit beta,IL-6RB,IL-6R-beta,IL6ST,Interleukin-6 receptor subunit beta,Interleukin-6 signal transducer,Membrane glycoprote 96T
U0046h CLIA CDw130,gp130,Homo sapiens,Human,IL-6 receptor subunit beta,IL-6R subunit beta,IL-6RB,IL-6R-beta,IL6ST,Interleukin-6 receptor subunit beta,Interleukin-6 signal transducer,Membrane glycoprotein 130 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur