Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Interleukin-17 receptor B (IL-17 receptor B) (IL-17RB) (Cytokine receptor-like 4) (IL-17 receptor homolog 1) (IL-17Rh1) (IL17Rh1) (Interleukin-17B receptor) (IL-17B receptor)

 I17RB_HUMAN             Reviewed;         502 AA.
Q9NRM6; Q9BPZ0; Q9NRL4; Q9NRM5;
27-MAY-2002, integrated into UniProtKB/Swiss-Prot.
27-MAY-2002, sequence version 2.
12-SEP-2018, entry version 154.
RecName: Full=Interleukin-17 receptor B;
Short=IL-17 receptor B;
Short=IL-17RB;
AltName: Full=Cytokine receptor-like 4;
AltName: Full=IL-17 receptor homolog 1;
Short=IL-17Rh1;
Short=IL17Rh1;
AltName: Full=Interleukin-17B receptor;
Short=IL-17B receptor;
Flags: Precursor;
Name=IL17RB; Synonyms=CRL4, EVI27, IL17BR; ORFNames=UNQ2501/PRO19612;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
PubMed=10815801; DOI=10.1038/sj.onc.1203577;
Tian E., Sawyer J.R., Largaespada D.A., Jenkins N.A., Copeland N.G.,
Shaughnessy J.D. Jr.;
"Evi27 encodes a novel membrane protein with homology to the IL17
receptor.";
Oncogene 19:2098-2109(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND PROTEIN SEQUENCE OF
N-TERMINUS.
TISSUE=Lung;
PubMed=10749887; DOI=10.1074/jbc.M910228199;
Shi Y., Ullrich S.J., Zhang J., Connolly K., Grzegorzewski K.J.,
Barber M.C., Wang W., Wathen K., Hodge V., Fisher C.L., Olsen H.,
Ruben S.M., Knyazev I., Cho Y.H., Kao V., Wilkinson K.A.,
Carrell J.A., Ebner R.;
"A novel cytokine receptor-ligand pair. Identification, molecular
characterization, and in vivo immunomodulatory activity.";
J. Biol. Chem. 275:19167-19176(2000).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Zhang W., Cao X.;
Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS LEU-278; THR-451;
SER-458 AND ARG-499.
SeattleSNPs variation discovery resource;
Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Cervix;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
PROTEIN SEQUENCE OF 18-32.
PubMed=15340161; DOI=10.1110/ps.04682504;
Zhang Z., Henzel W.J.;
"Signal peptide prediction based on analysis of experimentally
verified cleavage sites.";
Protein Sci. 13:2819-2824(2004).
[8]
FUNCTION.
PubMed=11058597; DOI=10.1074/jbc.M008289200;
Lee J., Ho W.-H., Maruoka M., Corpuz R.T., Baldwin D.T., Foster J.S.,
Goddard A.D., Yansura D.G., Vandlen R.L., Wood W.I., Gurney A.L.;
"IL-17E, a novel proinflammatory ligand for the IL-17 receptor homolog
IL-17Rh1.";
J. Biol. Chem. 276:1660-1664(2001).
[9]
SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
PubMed=14759258; DOI=10.1186/gb-2004-5-2-r8;
Hillman R.T., Green R.E., Brenner S.E.;
"An unappreciated role for RNA surveillance.";
Genome Biol. 5:R8.1-R8.16(2004).
[10]
INTERACTION WITH DAZAP2.
PubMed=22070932; DOI=10.1016/j.imbio.2011.10.004;
Popova A., Kzhyshkowska J., Nurgazieva D., Goerdt S., Gratchev A.;
"Smurf2 regulates IL17RB by proteasomal degradation of its novel
binding partner DAZAP2.";
Immunobiology 217:321-328(2012).
-!- FUNCTION: Receptor for the proinflammatory cytokines IL17B and
IL17E. May play a role in controlling the growth and/or
differentiation of hematopoietic cells.
{ECO:0000269|PubMed:11058597}.
-!- SUBUNIT: Interacts with DAZAP2. {ECO:0000269|PubMed:22070932}.
-!- SUBCELLULAR LOCATION: Isoform 1: Cell membrane; Single-pass type I
membrane protein.
-!- SUBCELLULAR LOCATION: Isoform 2: Secreted.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q9NRM6-1; Sequence=Displayed;
Name=2;
IsoId=Q9NRM6-2; Sequence=VSP_001740, VSP_001741;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
-!- TISSUE SPECIFICITY: Expressed in several endocrine tissues, mostly
in fetal and adult liver, kidney, pancreas, testis, colon, brain
and small intestine; not detected in peripheral blood leukocytes,
lymphoid organs, and most cell lines.
-!- WEB RESOURCE: Name=SeattleSNPs;
URL="http://pga.gs.washington.edu/data/il17rb/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF208110; AAF86051.1; -; mRNA.
EMBL; AF208111; AAF86052.1; -; mRNA.
EMBL; AF212365; AAF78776.1; -; mRNA.
EMBL; AF250309; AAK37428.1; -; mRNA.
EMBL; AY359122; AAQ89956.1; -; mRNA.
EMBL; AY518533; AAR89910.1; -; Genomic_DNA.
EMBL; BC000980; AAH00980.1; -; mRNA.
CCDS; CCDS2874.1; -. [Q9NRM6-1]
RefSeq; NP_061195.2; NM_018725.3. [Q9NRM6-1]
UniGene; Hs.654970; -.
ProteinModelPortal; Q9NRM6; -.
SMR; Q9NRM6; -.
BioGrid; 120708; 30.
IntAct; Q9NRM6; 2.
STRING; 9606.ENSP00000288167; -.
iPTMnet; Q9NRM6; -.
PhosphoSitePlus; Q9NRM6; -.
BioMuta; IL17RB; -.
DMDM; 21263748; -.
MaxQB; Q9NRM6; -.
PaxDb; Q9NRM6; -.
PeptideAtlas; Q9NRM6; -.
PRIDE; Q9NRM6; -.
ProteomicsDB; 82390; -.
ProteomicsDB; 82391; -. [Q9NRM6-2]
DNASU; 55540; -.
Ensembl; ENST00000288167; ENSP00000288167; ENSG00000056736. [Q9NRM6-1]
GeneID; 55540; -.
KEGG; hsa:55540; -.
UCSC; uc003dha.4; human. [Q9NRM6-1]
CTD; 55540; -.
DisGeNET; 55540; -.
EuPathDB; HostDB:ENSG00000056736.9; -.
GeneCards; IL17RB; -.
H-InvDB; HIX0119152; -.
HGNC; HGNC:18015; IL17RB.
HPA; HPA005482; -.
MIM; 605458; gene.
neXtProt; NX_Q9NRM6; -.
OpenTargets; ENSG00000056736; -.
PharmGKB; PA29796; -.
eggNOG; ENOG410IK7X; Eukaryota.
eggNOG; ENOG410YA4Q; LUCA.
GeneTree; ENSGT00880000137935; -.
HOGENOM; HOG000112985; -.
HOVERGEN; HBG052063; -.
InParanoid; Q9NRM6; -.
KO; K05165; -.
OMA; VYPSEIC; -.
OrthoDB; EOG091G01XZ; -.
PhylomeDB; Q9NRM6; -.
TreeFam; TF329644; -.
Reactome; R-HSA-448424; Interleukin-17 signaling.
SIGNOR; Q9NRM6; -.
GeneWiki; IL17RB; -.
GenomeRNAi; 55540; -.
PRO; PR:Q9NRM6; -.
Proteomes; UP000005640; Chromosome 3.
Bgee; ENSG00000056736; Expressed in 169 organ(s), highest expression level in adult mammalian kidney.
CleanEx; HS_IL17RB; -.
ExpressionAtlas; Q9NRM6; baseline and differential.
Genevisible; Q9NRM6; HS.
GO; GO:0009986; C:cell surface; IEA:Ensembl.
GO; GO:0005737; C:cytoplasm; IEA:Ensembl.
GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
GO; GO:0005887; C:integral component of plasma membrane; TAS:ProtInc.
GO; GO:0016020; C:membrane; NAS:UniProtKB.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0004896; F:cytokine receptor activity; NAS:UniProtKB.
GO; GO:0030368; F:interleukin-17 receptor activity; IBA:GO_Central.
GO; GO:0006952; P:defense response; TAS:ProtInc.
GO; GO:0097400; P:interleukin-17-mediated signaling pathway; TAS:Reactome.
GO; GO:0050729; P:positive regulation of inflammatory response; IEA:Ensembl.
GO; GO:2000667; P:positive regulation of interleukin-13 secretion; IEA:Ensembl.
GO; GO:2000664; P:positive regulation of interleukin-5 secretion; IEA:Ensembl.
GO; GO:0001558; P:regulation of cell growth; NAS:UniProtKB.
Gene3D; 2.60.40.2160; -; 1.
InterPro; IPR032356; IL17R_fnIII_D1.
InterPro; IPR038683; IL17RA/B_FnIII-like_1_sf.
InterPro; IPR013568; SEFIR_dom.
Pfam; PF16556; IL17R_fnIII_D1; 1.
Pfam; PF08357; SEFIR; 1.
PROSITE; PS51534; SEFIR; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Complete proteome;
Direct protein sequencing; Glycoprotein; Membrane; Polymorphism;
Receptor; Reference proteome; Secreted; Signal; Transmembrane;
Transmembrane helix.
SIGNAL 1 17 {ECO:0000269|PubMed:10749887,
ECO:0000269|PubMed:15340161}.
CHAIN 18 502 Interleukin-17 receptor B.
/FTId=PRO_0000011032.
TOPO_DOM 18 292 Extracellular. {ECO:0000255}.
TRANSMEM 293 313 Helical. {ECO:0000255}.
TOPO_DOM 314 502 Cytoplasmic. {ECO:0000255}.
DOMAIN 331 477 SEFIR. {ECO:0000255|PROSITE-
ProRule:PRU00867}.
CARBOHYD 67 67 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 103 103 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 156 156 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 183 183 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 197 197 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 283 283 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 250 288 LTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNKSKPG
-> VKFSELLWGGKGHRRLFHHSLLLRMSSLLSNALLPADT
S (in isoform 2).
{ECO:0000303|PubMed:10815801}.
/FTId=VSP_001740.
VAR_SEQ 289 502 Missing (in isoform 2).
{ECO:0000303|PubMed:10815801}.
/FTId=VSP_001741.
VARIANT 177 177 G -> R (in dbSNP:rs2232337).
/FTId=VAR_059304.
VARIANT 209 209 A -> V (in dbSNP:rs2232340).
/FTId=VAR_049178.
VARIANT 232 232 R -> Q (in dbSNP:rs2232343).
/FTId=VAR_049179.
VARIANT 278 278 F -> L (in dbSNP:rs2232346).
{ECO:0000269|Ref.5}.
/FTId=VAR_019209.
VARIANT 451 451 I -> T (in dbSNP:rs2232350).
{ECO:0000269|Ref.5}.
/FTId=VAR_019210.
VARIANT 458 458 N -> S (in dbSNP:rs2232351).
{ECO:0000269|Ref.5}.
/FTId=VAR_019211.
VARIANT 499 499 C -> R (in dbSNP:rs28385751).
{ECO:0000269|Ref.5}.
/FTId=VAR_019212.
CONFLICT 6 6 L -> I (in Ref. 1; AAF86051/AAF86052).
{ECO:0000305}.
CONFLICT 422 426 LFPLA -> SSPCL (in Ref. 2; AA sequence).
{ECO:0000305}.
CONFLICT 427 502 Missing (in Ref. 2; AA sequence).
{ECO:0000305}.
CONFLICT 468 468 L -> F (in Ref. 1; AAF86051).
{ECO:0000305}.
SEQUENCE 502 AA; 55885 MW; CDB87586FAAE49CC CRC64;
MSLVLLSLAA LCRSAVPREP TVQCGSETGP SPEWMLQHDL IPGDLRDLRV EPVTTSVATG
DYSILMNVSW VLRADASIRL LKATKICVTG KSNFQSYSCV RCNYTEAFQT QTRPSGGKWT
FSYIGFPVEL NTVYFIGAHN IPNANMNEDG PSMSVNFTSP GCLDHIMKYK KKCVKAGSLW
DPNITACKKN EETVEVNFTT TPLGNRYMAL IQHSTIIGFS QVFEPHQKKQ TRASVVIPVT
GDSEGATVQL TPYFPTCGSD CIRHKGTVVL CPQTGVPFPL DNNKSKPGGW LPLLLLSLLV
ATWVLVAGIY LMWRHERIKK TSFSTTTLLP PIKVLVVYPS EICFHHTICY FTEFLQNHCR
SEVILEKWQK KKIAEMGPVQ WLATQKKAAD KVVFLLSNDV NSVCDGTCGK SEGSPSENSQ
DLFPLAFNLF CSDLRSQIHL HKYVVVYFRE IDTKDDYNAL SVCPKYHLMK DATAFCAELL
HVKQQVSAGK RSQACHDGCC SL


Related products :

Catalog number Product name Quantity
EIAAB09420 Crlf2,Crlm2,CRLM-2,Cytokine receptor-like factor 2,Cytokine receptor-like molecule 2,Mouse,Mus musculus,Thymic stromal lymphopoietin protein receptor,Tpte2,TSLP receptor,Tslpr,Type I cytokine receptor
orb82731 Human IL4 protein Interleukin-4 (IL4) is a pleiotropic cytokine produced by activated T cells. IL4 is a ligandfor interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which maycontri 1 mg
EIAAB09419 CRL2,CRLF2,Cytokine receptor-like 2,Cytokine receptor-like factor 2,Homo sapiens,Human,ILXR,IL-XR,Thymic stromal lymphopoietin protein receptor,TSLP receptor,TSLPR
EIAAB09422 CREME9,CREME-9,CRLF3,Cytokine receptor-like factor 3,Cytokine receptor-like molecule 9,Cytokine receptor-related protein 4,CYTOR4,Homo sapiens,Human,P48,Type I cytokine receptor-like factor p48
E0066h ELISA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor typ 96T
E2006h ELISA CDw128b,C-X-C chemokine receptor type 2,CXCR2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,Homo sapiens,Human,IL-8 receptor type 2,IL-8R B,IL8RB 96T
E2006h ELISA kit CDw128b,C-X-C chemokine receptor type 2,CXCR2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,Homo sapiens,Human,IL-8 receptor type 2,IL-8R B,IL8RB 96T
U2006h CLIA CDw128b,C-X-C chemokine receptor type 2,CXCR2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,Homo sapiens,Human,IL-8 receptor type 2,IL-8R B,IL8RB 96T
U2006h CLIA kit CDw128b,C-X-C chemokine receptor type 2,CXCR2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,Homo sapiens,Human,IL-8 receptor type 2,IL-8R B,IL8RB 96T
U0066h CLIA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type 96T
U0066r CLIA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Rat,Rattus norve 96T
E0066m ELISA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus muscu 96T
E0066r ELISA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Rat,Rattus norv 96T
U0065m CLIA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus muscu 96T
U0065r CLIA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norvegi 96T
U0066m CLIA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus muscul 96T
E0065r ELISA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norveg 96T
E0065m ELISA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus musc 96T
E0065r ELISA kit CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus n 96T
E0066r ELISA kit CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Rat,Rattus 96T
E0066m ELISA kit CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus 96T
E0065m ELISA kit CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus 96T
EIAAB12410 Anhidrotic ectodysplasin receptor 1,DL,Downless homolog,Ectodermal dysplasia receptor,Ectodysplasin-A receptor,EDA-A1 receptor,EDAR,Homo sapiens,Human,Tumor necrosis factor receptor superfamily member
E1425h ELISA kit CRF2-1,Cytokine receptor class-II member 1,Cytokine receptor family 2 member 1,Homo sapiens,Human,IFN-alpha_beta receptor 1,IFNAR,IFNAR1,IFN-R-1,Interferon alpha_beta receptor 1,Type I inte 96T
E1425h ELISA CRF2-1,Cytokine receptor class-II member 1,Cytokine receptor family 2 member 1,Homo sapiens,Human,IFN-alpha_beta receptor 1,IFNAR,IFNAR1,IFN-R-1,Interferon alpha_beta receptor 1,Type I interfero 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur