Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Interleukin-17 receptor B (IL-17 receptor B) (IL-17RB) (IL-17 receptor homolog 1) (IL-17ER) (IL-17Rh1) (IL17Rh1) (Interleukin-17B receptor) (IL-17B receptor)

 I17RB_MOUSE             Reviewed;         499 AA.
Q9JIP3; Q9JIP2;
27-MAY-2002, integrated into UniProtKB/Swiss-Prot.
01-OCT-2000, sequence version 1.
12-SEP-2018, entry version 123.
RecName: Full=Interleukin-17 receptor B;
Short=IL-17 receptor B;
Short=IL-17RB;
AltName: Full=IL-17 receptor homolog 1;
Short=IL-17ER;
Short=IL-17Rh1;
Short=IL17Rh1;
AltName: Full=Interleukin-17B receptor;
Short=IL-17B receptor;
Flags: Precursor;
Name=Il17rb; Synonyms=Evi27, Il17br;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
PubMed=10815801; DOI=10.1038/sj.onc.1203577;
Tian E., Sawyer J.R., Largaespada D.A., Jenkins N.A., Copeland N.G.,
Shaughnessy J.D. Jr.;
"Evi27 encodes a novel membrane protein with homology to the IL17
receptor.";
Oncogene 19:2098-2109(2000).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
STRAIN=FVB/N; TISSUE=Kidney;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
-!- FUNCTION: Receptor for the proinflammatory cytokines IL17B and
IL17E. May play a role in controlling the growth and/or
differentiation of hematopoietic cells.
-!- SUBUNIT: Interacts with DAZAP2. {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Isoform 1: Cell membrane; Single-pass type I
membrane protein.
-!- SUBCELLULAR LOCATION: Isoform 2: Secreted.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q9JIP3-1; Sequence=Displayed;
Name=2;
IsoId=Q9JIP3-2; Sequence=VSP_001742, VSP_001743;
-!- TISSUE SPECIFICITY: Liver and testis. Expressed at lower level in
kidney and lung. Expressed in selected T-cell, B-cell and myeloid
cell lines.
-!- MISCELLANEOUS: Evi27 is a common site of retroviral integration in
Bxh2 murine myeloid leukemias, localized near the Il17rb gene.
Proviral integrations result in increased expression of Il17rb on
the cell surface.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF208108; AAF86049.1; -; mRNA.
EMBL; AF208109; AAF86050.1; -; mRNA.
EMBL; BC026546; AAH26546.1; -; mRNA.
CCDS; CCDS36845.1; -. [Q9JIP3-1]
RefSeq; NP_062529.2; NM_019583.3. [Q9JIP3-1]
UniGene; Mm.269363; -.
PDB; 3VBC; X-ray; 1.80 A; A=325-486.
PDBsum; 3VBC; -.
ProteinModelPortal; Q9JIP3; -.
SMR; Q9JIP3; -.
BioGrid; 206146; 2.
IntAct; Q9JIP3; 1.
STRING; 10090.ENSMUSP00000016110; -.
iPTMnet; Q9JIP3; -.
PhosphoSitePlus; Q9JIP3; -.
PaxDb; Q9JIP3; -.
PRIDE; Q9JIP3; -.
Ensembl; ENSMUST00000016110; ENSMUSP00000016110; ENSMUSG00000015966. [Q9JIP3-1]
GeneID; 50905; -.
KEGG; mmu:50905; -.
UCSC; uc007sun.1; mouse. [Q9JIP3-1]
CTD; 55540; -.
MGI; MGI:1355292; Il17rb.
eggNOG; ENOG410IK7X; Eukaryota.
eggNOG; ENOG410YA4Q; LUCA.
GeneTree; ENSGT00880000137935; -.
HOGENOM; HOG000112985; -.
HOVERGEN; HBG052063; -.
InParanoid; Q9JIP3; -.
KO; K05165; -.
OrthoDB; EOG091G01XZ; -.
Reactome; R-MMU-448424; Interleukin-17 signaling.
PRO; PR:Q9JIP3; -.
Proteomes; UP000000589; Chromosome 14.
Bgee; ENSMUSG00000015966; Expressed in 98 organ(s), highest expression level in secondary oocyte.
CleanEx; MM_IL17RB; -.
ExpressionAtlas; Q9JIP3; baseline and differential.
Genevisible; Q9JIP3; MM.
GO; GO:0009986; C:cell surface; IDA:MGI.
GO; GO:0005737; C:cytoplasm; IDA:MGI.
GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
GO; GO:0005887; C:integral component of plasma membrane; ISS:MGI.
GO; GO:0004896; F:cytokine receptor activity; ISS:MGI.
GO; GO:0030368; F:interleukin-17 receptor activity; IBA:GO_Central.
GO; GO:0050729; P:positive regulation of inflammatory response; IMP:MGI.
GO; GO:2000667; P:positive regulation of interleukin-13 secretion; IMP:MGI.
GO; GO:2000664; P:positive regulation of interleukin-5 secretion; IMP:MGI.
Gene3D; 2.60.40.2160; -; 1.
InterPro; IPR032356; IL17R_fnIII_D1.
InterPro; IPR038683; IL17RA/B_FnIII-like_1_sf.
InterPro; IPR013568; SEFIR_dom.
Pfam; PF16556; IL17R_fnIII_D1; 1.
Pfam; PF08357; SEFIR; 1.
PROSITE; PS51534; SEFIR; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Cell membrane; Complete proteome;
Glycoprotein; Membrane; Receptor; Reference proteome; Secreted;
Signal; Transmembrane; Transmembrane helix.
SIGNAL 1 17 {ECO:0000250}.
CHAIN 18 499 Interleukin-17 receptor B.
/FTId=PRO_0000011033.
TOPO_DOM 18 286 Extracellular. {ECO:0000255}.
TRANSMEM 287 307 Helical. {ECO:0000255}.
TOPO_DOM 308 499 Cytoplasmic. {ECO:0000255}.
DOMAIN 328 474 SEFIR. {ECO:0000255|PROSITE-
ProRule:PRU00867}.
CARBOHYD 67 67 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 103 103 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 156 156 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 197 197 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 163 218 LNHVMKYKKQCTEAGSLWDPDITACKKNEKMVEVNFTTNPL
GNRYTILIQRDTTLG -> TRENTEVTSGVFPAAKHQALRI
SAPFPLQFPPGPEDSVILPPQPLASLFHDFVKLT (in
isoform 2).
{ECO:0000303|PubMed:10815801}.
/FTId=VSP_001742.
VAR_SEQ 219 499 Missing (in isoform 2).
{ECO:0000303|PubMed:10815801}.
/FTId=VSP_001743.
STRAND 329 334 {ECO:0000244|PDB:3VBC}.
HELIX 339 341 {ECO:0000244|PDB:3VBC}.
HELIX 342 354 {ECO:0000244|PDB:3VBC}.
STRAND 358 362 {ECO:0000244|PDB:3VBC}.
HELIX 363 365 {ECO:0000244|PDB:3VBC}.
HELIX 367 373 {ECO:0000244|PDB:3VBC}.
HELIX 375 385 {ECO:0000244|PDB:3VBC}.
STRAND 387 393 {ECO:0000244|PDB:3VBC}.
HELIX 419 427 {ECO:0000244|PDB:3VBC}.
HELIX 428 430 {ECO:0000244|PDB:3VBC}.
STRAND 434 436 {ECO:0000244|PDB:3VBC}.
STRAND 440 444 {ECO:0000244|PDB:3VBC}.
HELIX 455 459 {ECO:0000244|PDB:3VBC}.
STRAND 462 464 {ECO:0000244|PDB:3VBC}.
TURN 465 468 {ECO:0000244|PDB:3VBC}.
HELIX 469 478 {ECO:0000244|PDB:3VBC}.
SEQUENCE 499 AA; 55617 MW; C66440430E3C31F3 CRC64;
MLLVLLILAA SCRSALPREP TIQCGSETGP SPEWMVQHTL TPGDLRDLQV ELVKTSVAAE
EFSILMNISW ILRADASIRL LKATKICVSG KNNMNSYSCV RCNYTEAFQS QTRPSGGKWT
FSYVGFPVEL STLYLISAHN IPNANMNEDS PSLSVNFTSP GCLNHVMKYK KQCTEAGSLW
DPDITACKKN EKMVEVNFTT NPLGNRYTIL IQRDTTLGFS RVLENKLMRT SVAIPVTEES
EGAVVQLTPY LHTCGNDCIR REGTVVLCSE TSAPIPPDDN RRMLGGWLPL FLVLLVAVWV
LAAGIYLTWR QGRSTKTSFP ISTMLLPLIK VLVVYPSEIC FHHTVCRFTD FLQNYCRSEV
ILEKWQKKKI AEMGPVQWLT TQKQAADKVV FLLPSDVPTL CDSACGHNEG SARENSQDLF
PLAFNLFCSD FSSQTHLHKY LVVYLGGADL KGDYNALSVC PQYHLMKDAT AFHTELLKAT
QSMSVKKRSQ ACHDSCSPL


Related products :

Catalog number Product name Quantity
103-M246 IL-17B receptor Anti-Mouse Host: Rat Il17rb; Evi27; Il17br; IL-17ER; IL17RH1; IL-17Rh1 100
103-M246 IL-17B receptor, Host: Rat, Species: Anti-Mouse, Synonyms: Il17rb; Evi27; Il17br; IL-17ER; IL17RH1; IL-17Rh1 100 ug
E0066h ELISA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor typ 96T
U0066h CLIA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type 96T
E0066r ELISA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Rat,Rattus norv 96T
E0066m ELISA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus muscu 96T
E0065m ELISA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus musc 96T
U0065r CLIA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norvegi 96T
U0066m CLIA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus muscul 96T
U0066r CLIA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Rat,Rattus norve 96T
E0065r ELISA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norveg 96T
U0065m CLIA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus muscu 96T
E0066m ELISA kit CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus 96T
E0066r ELISA kit CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Rat,Rattus 96T
E0065m ELISA kit CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus 96T
E0065r ELISA kit CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus n 96T
U2006h CLIA kit CDw128b,C-X-C chemokine receptor type 2,CXCR2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,Homo sapiens,Human,IL-8 receptor type 2,IL-8R B,IL8RB 96T
E2006h ELISA kit CDw128b,C-X-C chemokine receptor type 2,CXCR2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,Homo sapiens,Human,IL-8 receptor type 2,IL-8R B,IL8RB 96T
U2006h CLIA CDw128b,C-X-C chemokine receptor type 2,CXCR2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,Homo sapiens,Human,IL-8 receptor type 2,IL-8R B,IL8RB 96T
E2006h ELISA CDw128b,C-X-C chemokine receptor type 2,CXCR2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,Homo sapiens,Human,IL-8 receptor type 2,IL-8R B,IL8RB 96T
orb82731 Human IL4 protein Interleukin-4 (IL4) is a pleiotropic cytokine produced by activated T cells. IL4 is a ligandfor interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which maycontri 1 mg
EIAAB12410 Anhidrotic ectodysplasin receptor 1,DL,Downless homolog,Ectodermal dysplasia receptor,Ectodysplasin-A receptor,EDA-A1 receptor,EDAR,Homo sapiens,Human,Tumor necrosis factor receptor superfamily member
U2006r CLIA kit C-X-C chemokine receptor type 2,Cxcr2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,IL-8R B,Il8rb,Rat,Rattus norvegicus 96T
E2006r ELISA C-X-C chemokine receptor type 2,Cxcr2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,IL-8R B,Il8rb,Rat,Rattus norvegicus 96T
E2006r ELISA kit C-X-C chemokine receptor type 2,Cxcr2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,IL-8R B,Il8rb,Rat,Rattus norvegicus 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur