Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Interleukin-17 receptor C (IL-17 receptor C) (IL-17RC) (Interleukin-17 receptor homolog) (IL17Rhom) (Interleukin-17 receptor-like protein) (IL-17RL) (ZcytoR14)

 I17RC_HUMAN             Reviewed;         791 AA.
Q8NAC3; A8BWC1; A8BWC9; A8BWD5; E9PHG1; E9PHJ6; Q6UVY3; Q6UWD4;
Q8NFS1; Q9BR97;
21-JUN-2005, integrated into UniProtKB/Swiss-Prot.
05-MAY-2009, sequence version 2.
28-FEB-2018, entry version 128.
RecName: Full=Interleukin-17 receptor C;
Short=IL-17 receptor C;
Short=IL-17RC;
AltName: Full=Interleukin-17 receptor homolog;
Short=IL17Rhom;
AltName: Full=Interleukin-17 receptor-like protein;
Short=IL-17RL;
AltName: Full=ZcytoR14;
Flags: Precursor;
Name=IL17RC; ORFNames=UNQ6118/PRO20040/PRO38901;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5; 6 AND 7), FUNCTION,
SUBCELLULAR LOCATION, TISSUE SPECIFICITY, AND ALTERNATIVE SPLICING.
PubMed=17911633; DOI=10.4049/jimmunol.179.8.5462;
Kuestner R.E., Taft D.W., Haran A., Brandt C.S., Brender T., Lum K.,
Harder B., Okada S., Ostrander C.D., Kreindler J.L., Aujla S.J.,
Reardon B., Moore M., Shea P., Schreckhise R., Bukowski T.R.,
Presnell S., Guerra-Lewis P., Parrish-Novak J., Ellsworth J.L.,
Jaspers S., Lewis K.E., Appleby M., Kolls J.K., Rixon M., West J.W.,
Gao Z., Levin S.D.;
"Identification of the IL-17 receptor related molecule IL-17RC as the
receptor for IL-17F.";
J. Immunol. 179:5462-5473(2007).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8).
Presnell S.R., Burkhead S.K., Pownder S.L.;
Patent number JP2003504058, 04-FEB-2003.
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), AND VARIANT LEU-182.
Gilbert J.M., Gorman D.M.;
"Identification of novel IL-17 related receptors.";
Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
LEU-182.
TISSUE=Spleen;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16641997; DOI=10.1038/nature04728;
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R.,
Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R.,
Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V.,
Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.,
Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B.,
Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S.,
Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q.,
Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z.,
Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C.,
Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G.,
Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B.,
Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R.,
Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J.,
Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A.,
Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B.,
Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H.,
Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J.,
Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J.,
Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H.,
Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G.,
Gibbs R.A.;
"The DNA sequence, annotation and analysis of human chromosome 3.";
Nature 440:1194-1198(2006).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
TISSUE=Uterus;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
PROTEIN SEQUENCE OF 21-35.
PubMed=15340161; DOI=10.1110/ps.04682504;
Zhang Z., Henzel W.J.;
"Signal peptide prediction based on analysis of experimentally
verified cleavage sites.";
Protein Sci. 13:2819-2824(2004).
[9]
ALTERNATIVE SPLICING, AND TISSUE SPECIFICITY.
PubMed=11706037; DOI=10.1074/jbc.M109372200;
Haudenschild D., Moseley T., Rose L., Reddi A.H.;
"Soluble and transmembrane isoforms of novel interleukin-17 receptor-
like protein by RNA splicing and expression in prostate cancer.";
J. Biol. Chem. 277:4309-4316(2002).
[10]
INDUCTION BY HGF AND VEGF.
PubMed=14504135; DOI=10.1038/sj.bjp.0705494;
Gerritsen M.E., Tomlinson J.E., Zlot C., Ziman M., Hwang S.;
"Using gene expression profiling to identify the molecular basis of
the synergistic actions of hepatocyte growth factor and vascular
endothelial growth factor in human endothelial cells.";
Br. J. Pharmacol. 140:595-610(2003).
[11]
FUNCTION, AND SUBUNIT.
PubMed=16785495; DOI=10.4049/jimmunol.177.1.36;
Toy D., Kugler D., Wolfson M., Vanden Bos T., Gurgel J., Derry J.,
Tocker J., Peschon J.;
"Interleukin 17 signals through a heteromeric receptor complex.";
J. Immunol. 177:36-39(2006).
[12]
FUNCTION, AND SUBUNIT.
PubMed=18684971; DOI=10.4049/jimmunol.181.4.2799;
Wright J.F., Bennett F., Li B., Brooks J., Luxenberg D.P.,
Whitters M.J., Tomkinson K.N., Fitz L.J., Wolfman N.M., Collins M.,
Dunussi-Joannopoulos K., Chatterjee-Kishore M., Carreno B.M.;
"The human IL-17F/IL-17A heterodimeric cytokine signals through the
IL-17RA/IL-17RC receptor complex.";
J. Immunol. 181:2799-2805(2008).
[13]
INVOLVEMENT IN CANDF9.
PubMed=25918342; DOI=10.1084/jem.20141065;
Ling Y., Cypowyj S., Aytekin C., Galicchio M., Camcioglu Y.,
Nepesov S., Ikinciogullari A., Dogu F., Belkadi A., Levy R.,
Migaud M., Boisson B., Bolze A., Itan Y., Goudin N., Cottineau J.,
Picard C., Abel L., Bustamante J., Casanova J.L., Puel A.;
"Inherited IL-17RC deficiency in patients with chronic mucocutaneous
candidiasis.";
J. Exp. Med. 212:619-631(2015).
-!- FUNCTION: Receptor for IL17A and IL17F homodimers as part of a
heterodimeric complex with IL17RA (PubMed:16785495). Receptor for
the heterodimer formed by IL17A and IL17B as part of a
heterodimeric complex with IL17RA (PubMed:18684971). Has also been
shown to be the cognate receptor for IL17F and to bind IL17A with
high affinity without the need for IL17RA (PubMed:17911633).
Activation of IL17RC leads to induction of expression of
inflammatory chemokines and cytokines such as CXCL1
(PubMed:16785495). {ECO:0000269|PubMed:16785495,
ECO:0000269|PubMed:17911633, ECO:0000269|PubMed:18684971}.
-!- FUNCTION: Isoform 5: Receptor for both IL17A and IL17F.
{ECO:0000269|PubMed:16785495}.
-!- FUNCTION: Isoform 6: Does not bind IL17A or IL17F.
{ECO:0000269|PubMed:16785495}.
-!- FUNCTION: Isoform 7: Does not bind IL17A or IL17F.
{ECO:0000269|PubMed:16785495}.
-!- FUNCTION: Isoform 8: Receptor for both IL17A and IL17F.
{ECO:0000269|PubMed:16785495}.
-!- SUBUNIT: Heterodimer with IL17RA (PubMed:16785495,
PubMed:18684971). Heterodimerization with IL17RA is independent of
the cytoplasmic tail (By similarity). Associates with non-
glycosylated IL17RA constitutively (By similarity). Binding of
IL17A and IL17F induces association with glycosylated IL17RA (By
similarity). Interacts (via SEFIR domain and extended downstream
region) with TRAF3IP2/ACT1 (phosphorylated) (By similarity).
{ECO:0000250|UniProtKB:Q8K4C2, ECO:0000269|PubMed:16785495,
ECO:0000269|PubMed:18684971}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:17911633};
Single-pass type I membrane protein {ECO:0000255}. Note=Soluble
isoforms may be produced.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=8;
Comment=Additional isoforms seem to exist.;
Name=1;
IsoId=Q8NAC3-1; Sequence=Displayed;
Note=No experimental confirmation available.;
Name=2;
IsoId=Q8NAC3-2; Sequence=VSP_014138;
Name=3;
IsoId=Q8NAC3-3; Sequence=VSP_014138, VSP_014139;
Note=No experimental confirmation available.;
Name=4;
IsoId=Q8NAC3-4; Sequence=VSP_014138, VSP_014139, VSP_014140,
VSP_014141;
Note=No experimental confirmation available.;
Name=5; Synonyms=IL17RC {ECO:0000303|PubMed:17911633};
IsoId=Q8NAC3-5; Sequence=VSP_014138, VSP_047292;
Name=6; Synonyms=IL17RC-delta7,12 {ECO:0000303|PubMed:17911633};
IsoId=Q8NAC3-6; Sequence=VSP_014138, VSP_014139, VSP_047291;
Name=7; Synonyms=IL17RC-delta12 {ECO:0000303|PubMed:17911633};
IsoId=Q8NAC3-7; Sequence=VSP_014138, VSP_047291, VSP_047292;
Name=8; Synonyms=IL17RC-delta7 {ECO:0000303|PubMed:17911633};
IsoId=Q8NAC3-8; Sequence=VSP_014138, VSP_014139, VSP_047292;
-!- TISSUE SPECIFICITY: Expressed in prostate, skeletal muscle, kidney
and placenta (at protein level) (PubMed:11706037). Expressed in
brain, cartilage, colon, heart, intestine, kidney, liver, lung,
muscle, placenta, and prostate (PubMed:11706037). Also detected in
thyroid, trachea and adrenal gland (PubMed:17911633). Low
expression in thymus and leukocytes (PubMed:11706037).
{ECO:0000269|PubMed:11706037, ECO:0000269|PubMed:17911633}.
-!- INDUCTION: By HGF and VEGF. {ECO:0000269|PubMed:14504135}.
-!- DISEASE: Candidiasis, familial, 9 (CANDF9) [MIM:616445]: A
disorder characterized by altered immune responses and impaired
clearance of fungal infections, selective against Candida. It is
characterized by persistent and/or recurrent infections of the
skin, nails and mucous membranes caused by organisms of the genus
Candida, mainly Candida albicans. {ECO:0000269|PubMed:25918342}.
Note=The disease is caused by mutations affecting the gene
represented in this entry.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; EF676032; ABV44615.1; -; mRNA.
EMBL; EF676033; ABV44616.1; -; mRNA.
EMBL; EF676034; ABV44617.1; -; mRNA.
EMBL; BD292072; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; AF458065; AAM77569.1; -; mRNA.
EMBL; AY358840; AAQ89199.1; -; mRNA.
EMBL; AY359098; AAQ89456.1; -; mRNA.
EMBL; AK092907; BAC04001.1; -; mRNA.
EMBL; AC018809; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC006411; -; NOT_ANNOTATED_CDS; mRNA.
CCDS; CCDS2590.1; -. [Q8NAC3-1]
CCDS; CCDS2591.2; -. [Q8NAC3-3]
CCDS; CCDS46746.1; -. [Q8NAC3-2]
CCDS; CCDS56240.1; -. [Q8NAC3-5]
CCDS; CCDS56241.1; -. [Q8NAC3-6]
CCDS; CCDS74898.1; -. [Q8NAC3-7]
RefSeq; NP_001190192.1; NM_001203263.1.
RefSeq; NP_001190193.1; NM_001203264.1.
RefSeq; NP_001190194.1; NM_001203265.1.
RefSeq; NP_116121.2; NM_032732.5.
RefSeq; NP_703190.1; NM_153460.3.
RefSeq; NP_703191.1; NM_153461.3.
RefSeq; XP_016862835.1; XM_017007346.1. [Q8NAC3-8]
UniGene; Hs.129959; -.
ProteinModelPortal; Q8NAC3; -.
BioGrid; 124278; 53.
STRING; 9606.ENSP00000295981; -.
iPTMnet; Q8NAC3; -.
PhosphoSitePlus; Q8NAC3; -.
BioMuta; IL17RC; -.
DMDM; 229462881; -.
PaxDb; Q8NAC3; -.
PeptideAtlas; Q8NAC3; -.
PRIDE; Q8NAC3; -.
Ensembl; ENST00000295981; ENSP00000295981; ENSG00000163702. [Q8NAC3-1]
Ensembl; ENST00000383812; ENSP00000373323; ENSG00000163702. [Q8NAC3-3]
Ensembl; ENST00000403601; ENSP00000384969; ENSG00000163702. [Q8NAC3-2]
Ensembl; ENST00000413608; ENSP00000396064; ENSG00000163702. [Q8NAC3-5]
Ensembl; ENST00000416074; ENSP00000395315; ENSG00000163702. [Q8NAC3-7]
Ensembl; ENST00000455057; ENSP00000407894; ENSG00000163702. [Q8NAC3-6]
GeneID; 84818; -.
KEGG; hsa:84818; -.
UCSC; uc003btz.4; human. [Q8NAC3-1]
CTD; 84818; -.
DisGeNET; 84818; -.
EuPathDB; HostDB:ENSG00000163702.18; -.
GeneCards; IL17RC; -.
HGNC; HGNC:18358; IL17RC.
HPA; CAB026255; -.
HPA; HPA019885; -.
HPA; HPA048514; -.
MalaCards; IL17RC; -.
MIM; 610925; gene.
MIM; 616445; phenotype.
neXtProt; NX_Q8NAC3; -.
OpenTargets; ENSG00000163702; -.
PharmGKB; PA134986616; -.
eggNOG; ENOG410IES9; Eukaryota.
eggNOG; ENOG4111MUJ; LUCA.
GeneTree; ENSGT00730000111286; -.
HOGENOM; HOG000112986; -.
HOVERGEN; HBG081776; -.
InParanoid; Q8NAC3; -.
KO; K05166; -.
OMA; ALWACPM; -.
OrthoDB; EOG091G02KD; -.
PhylomeDB; Q8NAC3; -.
TreeFam; TF335852; -.
Reactome; R-HSA-448424; Interleukin-17 signaling.
ChiTaRS; IL17RC; human.
GeneWiki; IL17RC; -.
GenomeRNAi; 84818; -.
PRO; PR:Q8NAC3; -.
Proteomes; UP000005640; Chromosome 3.
Bgee; ENSG00000163702; -.
CleanEx; HS_IL17RC; -.
ExpressionAtlas; Q8NAC3; baseline and differential.
Genevisible; Q8NAC3; HS.
GO; GO:0009986; C:cell surface; IEA:Ensembl.
GO; GO:0005887; C:integral component of plasma membrane; IBA:GO_Central.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0030368; F:interleukin-17 receptor activity; IDA:MGI.
GO; GO:0005102; F:receptor binding; IEA:Ensembl.
GO; GO:0050832; P:defense response to fungus; IEA:Ensembl.
GO; GO:0071621; P:granulocyte chemotaxis; IEA:Ensembl.
GO; GO:0097400; P:interleukin-17-mediated signaling pathway; TAS:Reactome.
GO; GO:1900017; P:positive regulation of cytokine production involved in inflammatory response; IEA:Ensembl.
GO; GO:2000778; P:positive regulation of interleukin-6 secretion; IEA:Ensembl.
InterPro; IPR027841; IL-17_rcpt_C/E_N.
InterPro; IPR013568; SEFIR_dom.
Pfam; PF15037; IL17_R_N; 1.
Pfam; PF08357; SEFIR; 1.
PROSITE; PS51534; SEFIR; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Complete proteome;
Direct protein sequencing; Glycoprotein; Membrane; Polymorphism;
Receptor; Reference proteome; Signal; Transmembrane;
Transmembrane helix.
SIGNAL 1 20 {ECO:0000269|PubMed:15340161}.
CHAIN 21 791 Interleukin-17 receptor C.
/FTId=PRO_0000011034.
TOPO_DOM 21 538 Extracellular. {ECO:0000255}.
TRANSMEM 539 559 Helical. {ECO:0000255}.
TOPO_DOM 560 791 Cytoplasmic. {ECO:0000255}.
DOMAIN 583 735 SEFIR. {ECO:0000255|PROSITE-
ProRule:PRU00867}.
CARBOHYD 189 189 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 257 257 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 284 284 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 297 297 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 324 324 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 334 334 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 420 420 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 443 443 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 477 477 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 36 106 Missing (in isoform 2, isoform 3, isoform
4, isoform 5, isoform 6, isoform 7 and
isoform 8). {ECO:0000269|PubMed:17911633,
ECO:0000303|PubMed:12975309,
ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:17911633}.
/FTId=VSP_014138.
VAR_SEQ 264 278 Missing (in isoform 3, isoform 4, isoform
6 and isoform 8).
{ECO:0000269|PubMed:17911633,
ECO:0000303|PubMed:12975309,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_014139.
VAR_SEQ 425 441 Missing (in isoform 6 and isoform 7).
{ECO:0000269|PubMed:17911633,
ECO:0000305}.
/FTId=VSP_047291.
VAR_SEQ 566 578 Missing (in isoform 5, isoform 7 and
isoform 8). {ECO:0000269|PubMed:17911633,
ECO:0000305}.
/FTId=VSP_047292.
VAR_SEQ 579 624 AAARGRAALLLYSADDSGFERLVGALASALCQLPLRVAVDL
WSRRE -> GEWEQALGGGPPPGSQACASSPLPSPSVFSGS
GRQGPRGSAPLLSR (in isoform 4).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_014140.
VAR_SEQ 625 791 Missing (in isoform 4).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_014141.
VARIANT 182 182 S -> L (in dbSNP:rs708567).
{ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:17911633}.
/FTId=VAR_022680.
CONFLICT 241 241 E -> G (in Ref. 4; AAQ89199).
CONFLICT 378 378 Q -> R (in Ref. 1; ABV44615/ABV44616/
ABV44617, 2; BD292072, 3; AAM77569, 4;
AAQ89199/AAQ89456 and 5; BAC04001).
{ECO:0000305}.
SEQUENCE 791 AA; 86240 MW; E9A4032C17ECD4AF CRC64;
MPVPWFLLSL ALGRSPVVLS LERLVGPQDA THCSPVSLEP WGDEERLRVQ FLAQQSLSLA
PVTAATARTA LSGLSGADGR REERGRGKSW VCLSLGGSGN TEPQKKGLSC RLWDSDILCL
PGDIVPAPGP VLAPTHLQTE LVLRCQKETD CDLCLRVAVH LAVHGHWEEP EDEEKFGGAA
DSGVEEPRNA SLQAQVVLSF QAYPTARCVL LEVQVPAALV QFGQSVGSVV YDCFEAALGS
EVRIWSYTQP RYEKELNHTQ QLPDCRGLEV WNSIPSCWAL PWLNVSADGD NVHLVLNVSE
EQHFGLSLYW NQVQGPPKPR WHKNLTGPQI ITLNHTDLVP CLCIQVWPLE PDSVRTNICP
FREDPRAHQN LWQAARLQLL TLQSWLLDAP CSLPAEAALC WRAPGGDPCQ PLVPPLSWEN
VTVDKVLEFP LLKGHPNLCV QVNSSEKLQL QECLWADSLG PLKDDVLLLE TRGPQDNRSL
CALEPSGCTS LPSKASTRAA RLGEYLLQDL QSGQCLQLWD DDLGALWACP MDKYIHKRWA
LVWLACLLFA AALSLILLLK KDHAKGWLRL LKQDVRSGAA ARGRAALLLY SADDSGFERL
VGALASALCQ LPLRVAVDLW SRRELSAQGP VAWFHAQRRQ TLQEGGVVVL LFSPGAVALC
SEWLQDGVSG PGAHGPHDAF RASLSCVLPD FLQGRAPGSY VGACFDRLLH PDAVPALFRT
VPVFTLPSQL PDFLGALQQP RAPRSGRLQE RAEQVSRALQ PALDSYFHPP GTPAPGRGVG
PGAGPGAGDG T


Related products :

Catalog number Product name Quantity
orb82731 Human IL4 protein Interleukin-4 (IL4) is a pleiotropic cytokine produced by activated T cells. IL4 is a ligandfor interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which maycontri 1 mg
E0066h ELISA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor typ 96T
U0066h CLIA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type 96T
U0066r CLIA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Rat,Rattus norve 96T
E0066m ELISA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus muscu 96T
E0065m ELISA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus musc 96T
U0066m CLIA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus muscul 96T
U0065m CLIA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus muscu 96T
U0065r CLIA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norvegi 96T
E0066r ELISA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Rat,Rattus norv 96T
E0065r ELISA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norveg 96T
E0065r ELISA kit CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus n 96T
E0066m ELISA kit CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus 96T
E0066r ELISA kit CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Rat,Rattus 96T
E0065m ELISA kit CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus 96T
26-207 IL1RAPL2 is a member of the interleukin 1 receptor family. This protein is similar to the interleukin 1 accessory proteins, and is most closely related to interleukin 1 receptor accessory protein-like 0.05 mg
E0065h ELISA kit CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 r 96T
E0066h ELISA kit CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 recepto 96T
U0065h CLIA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recepto 96T
E0065h ELISA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recept 96T
orb82722 Human IL1 RN protein Recombinant Human Interleukin-1 Receptor Antagonist is a member of the Interleukin-1cytokine family. IL1RN inhibits the activities of Interleukin-1 alpha (IL1A) and Interleukin-1 1 mg
18-783-78379 GOAT ANTI IRAK4 (N-TERMINAL) - Interleukin-1 receptor-associated kinase 4 short form variant 4; Interleukin-1 receptor-associated kinase 4 short form variant 3; Interleukin-1 receptor-associated kinas 0.1 mg
U2006h CLIA kit CDw128b,C-X-C chemokine receptor type 2,CXCR2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,Homo sapiens,Human,IL-8 receptor type 2,IL-8R B,IL8RB 96T
E2006h ELISA kit CDw128b,C-X-C chemokine receptor type 2,CXCR2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,Homo sapiens,Human,IL-8 receptor type 2,IL-8R B,IL8RB 96T
E2006h ELISA CDw128b,C-X-C chemokine receptor type 2,CXCR2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,Homo sapiens,Human,IL-8 receptor type 2,IL-8R B,IL8RB 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur