Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (CD antigen CD123)

 IL3RA_HUMAN             Reviewed;         378 AA.
P26951; A8K3F3; B9VI81; Q5HYQ7; Q5HYQ8; Q9UEH7;
01-OCT-1993, integrated into UniProtKB/Swiss-Prot.
01-OCT-1993, sequence version 1.
20-JUN-2018, entry version 166.
RecName: Full=Interleukin-3 receptor subunit alpha;
Short=IL-3 receptor subunit alpha;
Short=IL-3R subunit alpha;
Short=IL-3R-alpha;
Short=IL-3RA;
AltName: CD_antigen=CD123;
Flags: Precursor;
Name=IL3RA; Synonyms=IL3R;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=1833064; DOI=10.1016/0092-8674(91)90039-2;
Kitamura T., Sato N., Arai K., Miyajima A.;
"Expression cloning of the human IL-3 receptor cDNA reveals a shared
beta subunit for the human IL-3 and GM-CSF receptors.";
Cell 66:1165-1174(1991).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=7887951; DOI=10.1006/bbrc.1995.1346;
Kosugi H., Nakagawa Y., Hotta T., Saito H., Miyajima A., Arai K.,
Yokota T.;
"Structure of the gene encoding the alpha subunit of the human
interleukin 3 receptor.";
Biochem. Biophys. Res. Commun. 208:360-367(1995).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), AND ALTERNATIVE SPLICING.
PubMed=19109256; DOI=10.1074/jbc.M808197200;
Chen J., Olsen J., Ford S., Mirza S., Walker A., Murphy J.M.,
Young I.G.;
"A new isoform of IL-3 receptor alpha with novel differentiation
activity and high affinity binding mode.";
J. Biol. Chem. 284:5763-5773(2009).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Lung;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS THR-12; GLY-77;
THR-123 AND LEU-323.
SeattleSNPs variation discovery resource;
Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], AND VARIANT THR-12.
PubMed=15772651; DOI=10.1038/nature03440;
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D.,
Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A.,
Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G.,
Jones M.C., Hurles M.E., Andrews T.D., Scott C.E., Searle S.,
Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R.,
Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L.,
Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A.,
Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S.,
Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R.,
Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M.,
Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N.,
Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D.,
Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W.,
Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C.,
Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C.,
Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S.,
Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S.,
Corby N., Connor R.E., David R., Davies J., Davis C., Davis J.,
Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S.,
Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I.,
Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L.,
Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P.,
Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S.,
Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A.,
Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J.,
Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J.,
Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S.,
de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z.,
Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C.,
Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W.,
Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D.,
Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H.,
McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T.,
Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I.,
Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N.,
Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J.,
Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E.,
Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S.,
Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K.,
Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D.,
Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R.,
Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T.,
Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S.,
Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L.,
Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A.,
Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L.,
Williams G., Williams L., Williamson A., Williamson H., Wilming L.,
Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H.,
Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A.,
Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F.,
Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A.,
Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T.,
Gibbs R.A., Beck S., Rogers J., Bentley D.R.;
"The DNA sequence of the human X chromosome.";
Nature 434:325-337(2005).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
-!- FUNCTION: This is a receptor for interleukin-3.
-!- SUBUNIT: Heterodimer of an alpha and a beta subunit. The beta
subunit is common to the IL3, IL5 and GM-CSF receptors.
-!- SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane
protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1; Synonyms=SP1;
IsoId=P26951-1; Sequence=Displayed;
Name=2; Synonyms=SP2;
IsoId=P26951-2; Sequence=VSP_040622;
-!- DOMAIN: The WSXWS motif appears to be necessary for proper protein
folding and thereby efficient intracellular transport and cell-
surface receptor binding.
-!- DOMAIN: The box 1 motif is required for JAK interaction and/or
activation.
-!- MISCELLANEOUS: The gene coding for this protein is located in the
pseudoautosomal region 1 (PAR1) of X and Y chromosomes.
-!- SIMILARITY: Belongs to the type I cytokine receptor family. Type 5
subfamily. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAA08393.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology
and Haematology;
URL="http://atlasgeneticsoncology.org/Genes/IL3RAID40959chXp22Yp13.html";
-!- WEB RESOURCE: Name=SeattleSNPs;
URL="http://pga.gs.washington.edu/data/il3ra/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; M74782; AAA59148.1; -; mRNA.
EMBL; D49410; BAA08393.1; ALT_SEQ; Genomic_DNA.
EMBL; FJ550347; ACM24116.1; -; mRNA.
EMBL; AK290568; BAF83257.1; -; mRNA.
EMBL; AY789109; AAV40832.1; -; Genomic_DNA.
EMBL; BX296563; CAI39694.1; -; Genomic_DNA.
EMBL; AL683870; CAI39694.1; JOINED; Genomic_DNA.
EMBL; BX119906; CAI39694.1; JOINED; Genomic_DNA.
EMBL; BX296563; CAI39695.1; -; Genomic_DNA.
EMBL; BX119906; CAI39695.1; JOINED; Genomic_DNA.
EMBL; BX901885; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC035407; AAH35407.1; -; mRNA.
CCDS; CCDS14113.1; -. [P26951-1]
CCDS; CCDS59158.1; -. [P26951-2]
PIR; A40266; A40266.
RefSeq; NP_001254642.1; NM_001267713.1. [P26951-2]
RefSeq; NP_002174.1; NM_002183.3. [P26951-1]
RefSeq; XP_005274488.1; XM_005274431.4. [P26951-1]
RefSeq; XP_005274837.1; XM_005274780.4. [P26951-1]
UniGene; Hs.632790; -.
PDB; 4JZJ; X-ray; 2.80 A; C/D=20-307.
PDB; 5UV8; X-ray; 2.70 A; A/G=20-307.
PDB; 5UWC; X-ray; 2.40 A; G=20-307.
PDBsum; 4JZJ; -.
PDBsum; 5UV8; -.
PDBsum; 5UWC; -.
ProteinModelPortal; P26951; -.
SMR; P26951; -.
BioGrid; 109778; 11.
DIP; DIP-3293N; -.
IntAct; P26951; 12.
STRING; 9606.ENSP00000327890; -.
DrugBank; DB00020; Sargramostim.
iPTMnet; P26951; -.
PhosphoSitePlus; P26951; -.
BioMuta; IL3RA; -.
DMDM; 417184; -.
PaxDb; P26951; -.
PeptideAtlas; P26951; -.
PRIDE; P26951; -.
ProteomicsDB; 54369; -.
ProteomicsDB; 54370; -. [P26951-2]
DNASU; 3563; -.
Ensembl; ENST00000331035; ENSP00000327890; ENSG00000185291. [P26951-1]
Ensembl; ENST00000381469; ENSP00000370878; ENSG00000185291. [P26951-2]
GeneID; 3563; -.
KEGG; hsa:3563; -.
UCSC; uc004cps.4; human. [P26951-1]
CTD; 3563; -.
DisGeNET; 3563; -.
EuPathDB; HostDB:ENSG00000185291.11; -.
GeneCards; IL3RA; -.
HGNC; HGNC:6012; IL3RA.
HPA; CAB018374; -.
HPA; HPA003539; -.
MIM; 308385; gene.
MIM; 430000; gene.
neXtProt; NX_P26951; -.
OpenTargets; ENSG00000185291; -.
PharmGKB; PA29831; -.
eggNOG; ENOG410IVI5; Eukaryota.
eggNOG; ENOG41118NI; LUCA.
GeneTree; ENSGT00520000055993; -.
HOGENOM; HOG000004539; -.
HOVERGEN; HBG107484; -.
InParanoid; P26951; -.
KO; K04737; -.
OMA; PHMKDPI; -.
OrthoDB; EOG091G0B8U; -.
PhylomeDB; P26951; -.
TreeFam; TF331549; -.
Reactome; R-HSA-392451; G beta:gamma signalling through PI3Kgamma.
Reactome; R-HSA-512988; Interleukin-3, 5 and GM-CSF signaling.
Reactome; R-HSA-5673001; RAF/MAP kinase cascade.
Reactome; R-HSA-912526; Interleukin receptor SHC signaling.
SignaLink; P26951; -.
SIGNOR; P26951; -.
GeneWiki; IL3RA; -.
GenomeRNAi; 3563; -.
PRO; PR:P26951; -.
Proteomes; UP000005640; Chromosome X.
Bgee; ENSG00000185291; -.
CleanEx; HS_IL3RA; -.
ExpressionAtlas; P26951; baseline and differential.
Genevisible; P26951; HS.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005622; C:intracellular; IEA:GOC.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0004912; F:interleukin-3 receptor activity; TAS:ProtInc.
GO; GO:0004713; F:protein tyrosine kinase activity; TAS:Reactome.
GO; GO:0005088; F:Ras guanyl-nucleotide exchange factor activity; TAS:Reactome.
GO; GO:0019221; P:cytokine-mediated signaling pathway; TAS:Reactome.
GO; GO:0000165; P:MAPK cascade; TAS:Reactome.
Gene3D; 2.60.40.10; -; 2.
InterPro; IPR036116; FN3_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003532; Short_hematopoietin_rcpt_2_CS.
InterPro; IPR015321; TypeI_recpt_CBD.
Pfam; PF09240; IL6Ra-bind; 1.
SUPFAM; SSF49265; SSF49265; 2.
PROSITE; PS01356; HEMATOPO_REC_S_F2; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Complete proteome; Glycoprotein;
Membrane; Polymorphism; Receptor; Reference proteome; Signal;
Transmembrane; Transmembrane helix.
SIGNAL 1 18 {ECO:0000255}.
CHAIN 19 378 Interleukin-3 receptor subunit alpha.
/FTId=PRO_0000010883.
TOPO_DOM 19 305 Extracellular. {ECO:0000255}.
TRANSMEM 306 325 Helical. {ECO:0000255}.
TOPO_DOM 326 378 Cytoplasmic. {ECO:0000255}.
MOTIF 282 286 WSXWS motif.
MOTIF 334 342 Box 1 motif.
CARBOHYD 46 46 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 64 64 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 80 80 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 109 109 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 212 212 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 218 218 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 22 100 DPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPA
VNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENS ->
G (in isoform 2).
{ECO:0000303|PubMed:19109256}.
/FTId=VSP_040622.
VARIANT 12 12 A -> T (in dbSNP:rs6647004).
{ECO:0000269|PubMed:15772651,
ECO:0000269|Ref.5}.
/FTId=VAR_021113.
VARIANT 77 77 E -> G (in dbSNP:rs17886756).
{ECO:0000269|Ref.5}.
/FTId=VAR_021114.
VARIANT 123 123 S -> T (in dbSNP:rs17883572).
{ECO:0000269|Ref.5}.
/FTId=VAR_021115.
VARIANT 323 323 V -> L (in dbSNP:rs17883366).
{ECO:0000269|Ref.5}.
/FTId=VAR_021116.
STRAND 31 33 {ECO:0000244|PDB:5UV8}.
TURN 34 37 {ECO:0000244|PDB:5UWC}.
STRAND 38 40 {ECO:0000244|PDB:5UV8}.
STRAND 52 54 {ECO:0000244|PDB:5UWC}.
TURN 55 57 {ECO:0000244|PDB:5UWC}.
STRAND 58 60 {ECO:0000244|PDB:5UWC}.
TURN 64 66 {ECO:0000244|PDB:5UWC}.
STRAND 67 69 {ECO:0000244|PDB:5UWC}.
STRAND 75 77 {ECO:0000244|PDB:5UWC}.
STRAND 79 83 {ECO:0000244|PDB:5UWC}.
TURN 86 89 {ECO:0000244|PDB:4JZJ}.
STRAND 92 97 {ECO:0000244|PDB:5UWC}.
STRAND 108 115 {ECO:0000244|PDB:5UWC}.
TURN 116 118 {ECO:0000244|PDB:5UWC}.
STRAND 119 125 {ECO:0000244|PDB:5UWC}.
STRAND 135 142 {ECO:0000244|PDB:5UWC}.
STRAND 148 150 {ECO:0000244|PDB:5UWC}.
STRAND 153 156 {ECO:0000244|PDB:5UWC}.
STRAND 162 168 {ECO:0000244|PDB:5UWC}.
HELIX 170 174 {ECO:0000244|PDB:5UWC}.
STRAND 179 187 {ECO:0000244|PDB:5UWC}.
STRAND 189 191 {ECO:0000244|PDB:5UWC}.
STRAND 196 201 {ECO:0000244|PDB:5UWC}.
HELIX 202 204 {ECO:0000244|PDB:5UWC}.
STRAND 212 216 {ECO:0000244|PDB:5UWC}.
STRAND 219 227 {ECO:0000244|PDB:5UWC}.
STRAND 236 243 {ECO:0000244|PDB:5UWC}.
STRAND 250 256 {ECO:0000244|PDB:5UWC}.
STRAND 258 264 {ECO:0000244|PDB:5UWC}.
STRAND 266 276 {ECO:0000244|PDB:5UWC}.
TURN 277 279 {ECO:0000244|PDB:5UWC}.
STRAND 289 292 {ECO:0000244|PDB:5UWC}.
SEQUENCE 378 AA; 43330 MW; 716CE1803F2E5FC0 CRC64;
MVLLWLTLLL IALPCLLQTK EDPNPPITNL RMKAKAQQLT WDLNRNVTDI ECVKDADYSM
PAVNNSYCQF GAISLCEVTN YTVRVANPPF STWILFPENS GKPWAGAENL TCWIHDVDFL
SCSWAVGPGA PADVQYDLYL NVANRRQQYE CLHYKTDAQG TRIGCRFDDI SRLSSGSQSS
HILVRGRSAA FGIPCTDKFV VFSQIEILTP PNMTAKCNKT HSFMHWKMRS HFNRKFRYEL
QIQKRMQPVI TEQVRDRTSF QLLNPGTYTV QIRARERVYE FLSAWSTPQR FECDQEEGAN
TRAWRTSLLI ALGTLLALVC VFVICRRYLV MQRLFPRIPH MKDPIGDSFQ NDKLVVWEAG
KAGLEECLVT EVQVVQKT


Related products :

Catalog number Product name Quantity
E0229h ELISA kit Homo sapiens,Human,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E0229h ELISA Homo sapiens,Human,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
U0229h CLIA Homo sapiens,Human,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
U1815h CLIA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E1815h ELISA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E1815h ELISA kit gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
U1815h CLIA kit gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E2031h ELISA 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
E2031h ELISA kit 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
U2031h CLIA 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
U2031h CLIA kit 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
E0229b ELISA Bos taurus,Bovine,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
U0229b CLIA Bos taurus,Bovine,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E0229b ELISA kit Bos taurus,Bovine,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
U2031m CLIA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
E2031r ELISA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
E2031m ELISA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
U2031r CLIA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
U1815r CLIA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
E1815m ELISA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
E2031m ELISA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
U1815m CLIA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
E2031r ELISA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
U1815m CLIA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
U2031r CLIA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur