Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Interleukin-36 gamma (IL-1-related protein 2) (IL-1RP2) (Interleukin-1 epsilon) (IL-1 epsilon) (Interleukin-1 family member 9) (IL-1F9) (Interleukin-1 homolog 1) (IL-1H1)

 IL36G_HUMAN             Reviewed;         169 AA.
Q9NZH8; Q56B91; Q6UVX7; Q7RTZ9;
08-NOV-2002, integrated into UniProtKB/Swiss-Prot.
01-OCT-2000, sequence version 1.
12-SEP-2018, entry version 142.
RecName: Full=Interleukin-36 gamma;
AltName: Full=IL-1-related protein 2;
Short=IL-1RP2;
AltName: Full=Interleukin-1 epsilon;
Short=IL-1 epsilon;
AltName: Full=Interleukin-1 family member 9;
Short=IL-1F9;
AltName: Full=Interleukin-1 homolog 1;
Short=IL-1H1;
Flags: Precursor;
Name=IL36G; Synonyms=IL1E, IL1F9, IL1H1, IL1RP2;
ORFNames=UNQ2456/PRO5737;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND INDUCTION.
TISSUE=Keratinocyte;
PubMed=10744718; DOI=10.1074/jbc.275.14.10308;
Kumar S., McDonnell P.C., Lehr R., Tierney L., Tzimas M.N.,
Griswold D.E., Capper E.A., Tal-Singer R., Wells G.I., Doyle M.L.,
Young P.R.;
"Identification and initial characterization of four novel members of
the interleukin-1 family.";
J. Biol. Chem. 275:10308-10314(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND CHARACTERIZATION.
TISSUE=Epithelium;
PubMed=11466363; DOI=10.4049/jimmunol.167.3.1440;
Debets R., Timans J.C., Homey B., Zurawski S., Sana T.R., Lo S.,
Wagner J., Edwards G., Clifford T., Menon S., Bazan J.F.,
Kastelein R.A.;
"Two novel IL-1 family members, IL-1 delta and IL-1 epsilon, function
as an antagonist and agonist of NF-kappa B activation through the
orphan IL-1 receptor-related protein 2.";
J. Immunol. 167:1440-1446(2001).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=10860666; DOI=10.1006/geno.2000.6184;
Busfield S.J., Comrack C.A., Yu G., Chickering T.W., Smutko J.S.,
Zhou H., Leiby K.R., Holmgren L.M., Gearing D.P., Pan Y.;
"Identification and gene organization of three novel members of the
IL-1 family on human chromosome 2.";
Genomics 66:213-216(2000).
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=11991722; DOI=10.1006/geno.2002.6751;
Nicklin M.J.H., Barton J.L., Nguyen M., Fitzgerald M.G., Duff W.G.,
Kornman K.;
"A sequence-based map of the nine genes of the human interleukin-1
cluster.";
Genomics 79:718-725(2002).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[6]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
SeattleSNPs variation discovery resource;
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[9]
FUNCTION, TISSUE SPECIFICITY, AND SUBCELLULAR LOCATION.
PubMed=20870894; DOI=10.1165/rcmb.2010-0075OC;
Chustz R.T., Nagarkar D.R., Poposki J.A., Favoreto S. Jr., Avila P.C.,
Schleimer R.P., Kato A.;
"Regulation and function of the IL-1 family cytokine IL-1F9 in human
bronchial epithelial cells.";
Am. J. Respir. Cell Mol. Biol. 45:145-153(2011).
[10]
FUNCTION, AND PROCESSING.
PubMed=21965679; DOI=10.1074/jbc.M111.267922;
Towne J.E., Renshaw B.R., Douangpanya J., Lipsky B.P., Shen M.,
Gabel C.A., Sims J.E.;
"Interleukin-36 (IL-36) ligands require processing for full agonist
(IL-36alpha, IL-36beta, and IL-36gamma) or antagonist (IL-36Ra)
activity.";
J. Biol. Chem. 286:42594-42602(2011).
[11]
FUNCTION, AND TISSUE SPECIFICITY.
PubMed=23095752; DOI=10.1074/jbc.M112.385443;
Bachmann M., Scheiermann P., Hardle L., Pfeilschifter J., Muhl H.;
"IL-36gamma/IL-1F9, an innate T-bet target in myeloid cells.";
J. Biol. Chem. 287:41684-41696(2012).
[12]
FUNCTION, AND INDUCTION.
PubMed=23147407; DOI=10.1002/eji.201242711;
Gresnigt M.S., Roesler B., Jacobs C.W., Becker K.L., Joosten L.A.,
van der Meer J.W., Netea M.G., Dinarello C.A., van de Veerdonk F.L.;
"The IL-36 receptor pathway regulates Aspergillus fumigatus-induced
Th1 and Th17 responses.";
Eur. J. Immunol. 43:416-426(2013).
[13]
FUNCTION.
PubMed=24829417; DOI=10.4049/jimmunol.1301481;
Foster A.M., Baliwag J., Chen C.S., Guzman A.M., Stoll S.W.,
Gudjonsson J.E., Ward N.L., Johnston A.;
"IL-36 promotes myeloid cell infiltration, activation, and
inflammatory activity in skin.";
J. Immunol. 192:6053-6061(2014).
-!- FUNCTION: Cytokine that binds to and signals through the
IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK
signaling pathways in target cells. Part of the IL-36 signaling
system that is thought to be present in epithelial barriers and to
take part in local inflammatory response; similar to the IL-1
system with which it shares the coreceptor IL1RAP. Seems to be
involved in skin inflammatory response by acting on keratinocytes,
dendritic cells and indirectly on T-cells to drive tissue
infiltration, cell maturation and cell proliferation. In cultured
keratinocytes induces the expression of macrophage, T-cell, and
neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17,
CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1;
also stimulates its own expression and that of the prototypic
cutaneous proinflammatory parameters TNF-alpha, S100A7/psoriasin
and inducible NOS. May play a role in proinflammatory responses
during particular neutrophilic airway inflammation: activates
mitogen-activated protein kinases and NF-kappa B in primary lung
fibroblasts, and stimulates the expression of IL-8 and CXCL3 and
Th17 chemokine CCL20 in lung fibroblasts. May be involved in the
innate immune response to fungal pathogens, such as Aspergillus
fumigatus. {ECO:0000269|PubMed:11466363,
ECO:0000269|PubMed:20870894, ECO:0000269|PubMed:21965679,
ECO:0000269|PubMed:23095752, ECO:0000269|PubMed:23147407,
ECO:0000269|PubMed:24829417}.
-!- SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:20870894}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q9NZH8-1; Sequence=Displayed;
Name=2;
IsoId=Q9NZH8-2; Sequence=VSP_013002;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Highly expressed in tissues containing
epithelial cells: skin, lung, stomach and esophagus. Expressed in
bronchial epithelial. In skin is expressed only in keratinocytes
but not in fibroblasts, endothelial cells or melanocytes. Up-
regulated in lesional psoriasis skin. Expressed in monocyte-
derived dendritic cells and M1 macrophages.
{ECO:0000269|PubMed:20870894, ECO:0000269|PubMed:23095752}.
-!- INDUCTION: By TNF and by IFNG/IFN-gamma in keratinocytes. By
Aspergillus fumigatus conidia in peripheral blood mnonocytes;
involves CLEC7A and SYK. {ECO:0000269|PubMed:10744718,
ECO:0000269|PubMed:23147407}.
-!- PTM: N-terminal truncation leads to a dramatic enhancement of its
activity (>1000-fold). {ECO:0000269|PubMed:21965679}.
-!- SIMILARITY: Belongs to the IL-1 family. {ECO:0000305}.
-!- WEB RESOURCE: Name=Wikipedia; Note=Interleukin-1 entry;
URL="https://en.wikipedia.org/wiki/Interleukin_1";
-!- WEB RESOURCE: Name=SeattleSNPs;
URL="http://pga.gs.washington.edu/data/il1f9/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF200492; AAF69248.1; -; mRNA.
EMBL; AF206696; AAG35670.1; -; mRNA.
EMBL; BN000002; CAD29874.1; -; Genomic_DNA.
EMBL; AY359111; AAQ89469.1; -; mRNA.
EMBL; AY968311; AAX59035.1; -; Genomic_DNA.
EMBL; AC016724; AAY14987.1; -; Genomic_DNA.
EMBL; BC096721; AAH96721.1; -; mRNA.
EMBL; BC098130; AAH98130.1; -; mRNA.
EMBL; BC098155; AAH98155.1; -; mRNA.
EMBL; BC098337; AAH98337.1; -; mRNA.
CCDS; CCDS2108.1; -. [Q9NZH8-1]
CCDS; CCDS62992.1; -. [Q9NZH8-2]
RefSeq; NP_001265497.1; NM_001278568.1. [Q9NZH8-2]
RefSeq; NP_062564.1; NM_019618.3. [Q9NZH8-1]
UniGene; Hs.211238; -.
PDB; 4IZE; X-ray; 2.00 A; A=18-169.
PDB; 4P0J; X-ray; 2.30 A; A/B=154-160.
PDB; 4P0K; X-ray; 1.70 A; A=64-72, A=154-160.
PDB; 4P0L; X-ray; 1.55 A; A=64-72, A=154-160.
PDBsum; 4IZE; -.
PDBsum; 4P0J; -.
PDBsum; 4P0K; -.
PDBsum; 4P0L; -.
ProteinModelPortal; Q9NZH8; -.
SMR; Q9NZH8; -.
BioGrid; 121135; 8.
STRING; 9606.ENSP00000259205; -.
iPTMnet; Q9NZH8; -.
PhosphoSitePlus; Q9NZH8; -.
EPD; Q9NZH8; -.
PaxDb; Q9NZH8; -.
PeptideAtlas; Q9NZH8; -.
PRIDE; Q9NZH8; -.
ProteomicsDB; 83397; -.
ProteomicsDB; 83398; -. [Q9NZH8-2]
Ensembl; ENST00000259205; ENSP00000259205; ENSG00000136688. [Q9NZH8-1]
Ensembl; ENST00000376489; ENSP00000365672; ENSG00000136688. [Q9NZH8-2]
GeneID; 56300; -.
KEGG; hsa:56300; -.
UCSC; uc002tio.3; human. [Q9NZH8-1]
CTD; 56300; -.
DisGeNET; 56300; -.
EuPathDB; HostDB:ENSG00000136688.10; -.
GeneCards; IL36G; -.
HGNC; HGNC:15741; IL36G.
MIM; 605542; gene.
neXtProt; NX_Q9NZH8; -.
OpenTargets; ENSG00000136688; -.
PharmGKB; PA38395; -.
eggNOG; ENOG410J1V3; Eukaryota.
eggNOG; ENOG4111C31; LUCA.
GeneTree; ENSGT00900000141014; -.
HOVERGEN; HBG052100; -.
InParanoid; Q9NZH8; -.
KO; K05487; -.
OMA; DLNQQVW; -.
OrthoDB; EOG091G0V8E; -.
PhylomeDB; Q9NZH8; -.
TreeFam; TF300203; -.
Reactome; R-HSA-9014826; Interleukin-36 pathway.
SignaLink; Q9NZH8; -.
GeneWiki; IL1F9; -.
GenomeRNAi; 56300; -.
PRO; PR:Q9NZH8; -.
Proteomes; UP000005640; Chromosome 2.
Bgee; ENSG00000136688; Expressed in 63 organ(s), highest expression level in periodontal ligament.
CleanEx; HS_IL1F9; -.
ExpressionAtlas; Q9NZH8; baseline and differential.
Genevisible; Q9NZH8; HS.
GO; GO:0005576; C:extracellular region; TAS:Reactome.
GO; GO:0005615; C:extracellular space; IBA:GO_Central.
GO; GO:0005125; F:cytokine activity; IBA:GO_Central.
GO; GO:0005149; F:interleukin-1 receptor binding; IBA:GO_Central.
GO; GO:0007267; P:cell-cell signaling; TAS:ProtInc.
GO; GO:0019221; P:cytokine-mediated signaling pathway; IBA:GO_Central.
GO; GO:0006954; P:inflammatory response; IEA:UniProtKB-KW.
GO; GO:0045087; P:innate immune response; IEA:UniProtKB-KW.
InterPro; IPR000975; IL-1_fam.
InterPro; IPR003297; IL-1RA/IL-36.
InterPro; IPR008996; IL1/FGF.
Pfam; PF00340; IL1; 1.
PRINTS; PR00264; INTERLEUKIN1.
PRINTS; PR01360; INTRLEUKIN1X.
SUPFAM; SSF50353; SSF50353; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Complete proteome; Cytokine;
Immunity; Inflammatory response; Innate immunity; Polymorphism;
Reference proteome; Secreted.
PROPEP 1 17 {ECO:0000269|PubMed:21965679}.
/FTId=PRO_0000430549.
CHAIN 18 169 Interleukin-36 gamma.
/FTId=PRO_0000153648.
VAR_SEQ 19 54 MCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPV -> I
(in isoform 2).
{ECO:0000303|PubMed:12975309}.
/FTId=VSP_013002.
VARIANT 69 69 Q -> K (in dbSNP:rs6707930).
/FTId=VAR_024505.
STRAND 23 29 {ECO:0000244|PDB:4IZE}.
STRAND 33 38 {ECO:0000244|PDB:4IZE}.
STRAND 41 46 {ECO:0000244|PDB:4IZE}.
HELIX 47 49 {ECO:0000244|PDB:4IZE}.
STRAND 55 60 {ECO:0000244|PDB:4IZE}.
HELIX 64 66 {ECO:0000244|PDB:4P0L}.
HELIX 69 71 {ECO:0000244|PDB:4P0L}.
STRAND 73 80 {ECO:0000244|PDB:4IZE}.
TURN 81 83 {ECO:0000244|PDB:4IZE}.
STRAND 84 89 {ECO:0000244|PDB:4IZE}.
STRAND 91 94 {ECO:0000244|PDB:4IZE}.
STRAND 96 101 {ECO:0000244|PDB:4IZE}.
HELIX 104 109 {ECO:0000244|PDB:4IZE}.
STRAND 110 112 {ECO:0000244|PDB:4IZE}.
HELIX 115 117 {ECO:0000244|PDB:4IZE}.
STRAND 118 124 {ECO:0000244|PDB:4IZE}.
STRAND 127 135 {ECO:0000244|PDB:4IZE}.
STRAND 139 142 {ECO:0000244|PDB:4IZE}.
STRAND 150 153 {ECO:0000244|PDB:4IZE}.
STRAND 156 160 {ECO:0000244|PDB:4P0L}.
STRAND 163 167 {ECO:0000244|PDB:4IZE}.
SEQUENCE 169 AA; 18721 MW; F00A9243706F4154 CRC64;
MRGTPGDADG GGRAVYQSMC KPITGTINDL NQQVWTLQGQ NLVAVPRSDS VTPVTVAVIT
CKYPEALEQG RGDPIYLGIQ NPEMCLYCEK VGEQPTLQLK EQKIMDLYGQ PEPVKPFLFY
RAKTGRTSTL ESVAFPDWFI ASSKRDQPII LTSELGKSYN TAFELNIND


Related products :

Catalog number Product name Quantity
E2205h Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interleukin-36 ga
E2205h ELISA Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interleukin 96T
U2205h CLIA Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interleukin- 96T
E2205h ELISA kit Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interl 96T
U2205h CLIA kit Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interle 96T
orb82722 Human IL1 RN protein Recombinant Human Interleukin-1 Receptor Antagonist is a member of the Interleukin-1cytokine family. IL1RN inhibits the activities of Interleukin-1 alpha (IL1A) and Interleukin-1 1 mg
26-207 IL1RAPL2 is a member of the interleukin 1 receptor family. This protein is similar to the interleukin 1 accessory proteins, and is most closely related to interleukin 1 receptor accessory protein-like 0.05 mg
E2205m Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus
E2205m ELISA kit Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
U2205m CLIA kit Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
E2205m ELISA Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
U2205m CLIA Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
IL1F8 IL1F6 Gene interleukin 1 family, member 6 (epsilon)
E0066h ELISA kit CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 recepto 96T
E0065h ELISA kit CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 r 96T
U0065h CLIA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recepto 96T
E0065h ELISA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recept 96T
E0066h ELISA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor typ 96T
18-321-177008 INTERLEUKIN 6 CROSS REACTIVE WITH RAT INTERLEUKIN 6 - POLYCLONAL ANTIBODY TO MOUSE INTERLEUKIN 6 CROSS REACTIVE WITH RAT INTERLEUKIN 6; IL-6; Interleukin HP-1; B-cell hybridoma growth factor Polyclona 0.1 mg
CSB-EL011617HU Human interleukin 1 family, member 6 (epsilon) (IL1F6) ELISA kit, Species Human, Sample Type serum, plasma 96T
E2103h ELISA Cytokine Zcyto7,Homo sapiens,Human,IL17B,IL-17B,IL20,IL-20,Interleukin-17B,Interleukin-20,Neuronal interleukin-17-related factor,NIRF,UNQ516_PRO1031,ZCYTO7 96T
E2103h ELISA kit Cytokine Zcyto7,Homo sapiens,Human,IL17B,IL-17B,IL20,IL-20,Interleukin-17B,Interleukin-20,Neuronal interleukin-17-related factor,NIRF,UNQ516_PRO1031,ZCYTO7 96T
U2103h CLIA kit Cytokine Zcyto7,Homo sapiens,Human,IL17B,IL-17B,IL20,IL-20,Interleukin-17B,Interleukin-20,Neuronal interleukin-17-related factor,NIRF,UNQ516_PRO1031,ZCYTO7 96T
U2103h CLIA Cytokine Zcyto7,Homo sapiens,Human,IL17B,IL-17B,IL20,IL-20,Interleukin-17B,Interleukin-20,Neuronal interleukin-17-related factor,NIRF,UNQ516_PRO1031,ZCYTO7 96T
U0066h CLIA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur