Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Interleukin-37 (FIL1 zeta) (IL-1X) (Interleukin-1 family member 7) (IL-1F7) (Interleukin-1 homolog 4) (IL-1H) (IL-1H4) (Interleukin-1 zeta) (IL-1 zeta) (Interleukin-1-related protein) (IL-1RP1) (Interleukin-23) (IL-37)

 IL37_HUMAN              Reviewed;         218 AA.
Q9NZH6; B5BU97; Q56AP9; Q8TD04; Q8TD05; Q9HBF2; Q9HBF3; Q9UHA6;
08-NOV-2002, integrated into UniProtKB/Swiss-Prot.
01-OCT-2000, sequence version 1.
30-AUG-2017, entry version 146.
RecName: Full=Interleukin-37;
AltName: Full=FIL1 zeta;
AltName: Full=IL-1X;
AltName: Full=Interleukin-1 family member 7;
Short=IL-1F7;
AltName: Full=Interleukin-1 homolog 4;
Short=IL-1H;
Short=IL-1H4;
AltName: Full=Interleukin-1 zeta;
Short=IL-1 zeta;
AltName: Full=Interleukin-1-related protein;
Short=IL-1RP1;
AltName: Full=Interleukin-23;
Short=IL-37;
Flags: Precursor;
Name=IL37; Synonyms=FIL1Z, IL1F7, IL1H4, IL1RP1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
TISSUE=Fetal B-cell, Fetal colon, Fetal lung, and Fetal testis;
PubMed=10744718; DOI=10.1074/jbc.275.14.10308;
Kumar S., McDonnell P.C., Lehr R., Tierney L., Tzimas M.N.,
Griswold D.E., Capper E.A., Tal-Singer R., Wells G.I., Doyle M.L.,
Young P.R.;
"Identification and initial characterization of four novel members of
the interleukin-1 family.";
J. Biol. Chem. 275:10308-10314(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
TISSUE=Colon carcinoma;
Manoj P.P., Mantovani A., Muzio M.;
Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B AND C), PROTEIN SEQUENCE OF
46-54, INTERACTION WITH IL18R1, SUBCELLULAR LOCATION, TISSUE
SPECIFICITY, AND VARIANTS VAL-31 AND ALA-42.
PubMed=11145836; DOI=10.1006/cyto.2000.0799;
Pan G., Risser P., Mao W., Baldwin D.T., Zhong A.W., Filvaroff E.,
Yansura D., Lewis L., Eigenbrot C., Henzel W.J., Vandlen R.;
"IL-1H, an interleukin 1-related protein that binds IL-18 receptor/IL-
1Rrp.";
Cytokine 13:1-7(2001).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
PubMed=10625660; DOI=10.1074/jbc.275.2.1169;
Smith D.E., Renshaw B.R., Ketchem R.R., Kubin M., Garka K.E.,
Sims J.E.;
"Four new members expand the IL-1 superfamily.";
J. Biol. Chem. 275:1169-1175(2000).
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS D AND E).
PubMed=11991723; DOI=10.1006/geno.2002.6752;
Taylor S.L., Renshaw B.R., Garka K.E., Smith D.E., Sims J.E.;
"Genomic organization of the interleukin-1 locus.";
Genomics 79:726-733(2002).
[6]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS VAL-31; ALA-42;
LEU-108; TRP-152; ARG-164 AND ASN-218.
SeattleSNPs variation discovery resource;
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM D).
PubMed=19054851; DOI=10.1038/nmeth.1273;
Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R.,
Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y.,
Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B.,
Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H.,
Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M.,
Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T.,
Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A.,
Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K.,
Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S.,
Isogai T., Imai J., Watanabe S., Nomura N.;
"Human protein factory for converting the transcriptome into an in
vitro-expressed proteome.";
Nat. Methods 5:1011-1017(2008).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B), AND VARIANTS
VAL-31 AND ALA-42.
TISSUE=Placenta;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[11]
FUNCTION, SUBCELLULAR LOCATION, MATURATION BY CASP1, AND INDUCTION.
PubMed=18390730; DOI=10.4049/jimmunol.180.8.5477;
Sharma S., Kulk N., Nold M.F., Graf R., Kim S.H., Reinhardt D.,
Dinarello C.A., Bufler P.;
"The IL-1 family member 7b translocates to the nucleus and down-
regulates proinflammatory cytokines.";
J. Immunol. 180:5477-5482(2008).
[12]
FUNCTION, INTERACTION WITH SMAD3, SUBCELLULAR LOCATION, TISSUE
SPECIFICITY, AND INDUCTION.
PubMed=20935647; DOI=10.1038/ni.1944;
Nold M.F., Nold-Petry C.A., Zepp J.A., Palmer B.E., Bufler P.,
Dinarello C.A.;
"IL-37 is a fundamental inhibitor of innate immunity.";
Nat. Immunol. 11:1014-1022(2010).
-!- FUNCTION: Suppressor of innate inflammatory and immune responses
involved in curbing excessive inflammation. This function requires
SMAD3. Suppresses, or reduces, proinflammatory cytokine
production, including IL1A and IL6, as well as CCL12, CSF1, CSF2,
CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory
cytokines. Inhibits dendritic cell activation.
{ECO:0000269|PubMed:18390730, ECO:0000269|PubMed:20935647}.
-!- SUBUNIT: Interacts with SMAD3. Binds IL18R1, but not to IL1R1,
with lower affinity than IL18, and does not seem to act as a
receptor antagonist for IL18. {ECO:0000269|PubMed:11145836,
ECO:0000269|PubMed:20935647}.
-!- SUBCELLULAR LOCATION: Cytoplasm, cytosol
{ECO:0000269|PubMed:18390730, ECO:0000269|PubMed:20935647}.
Nucleus {ECO:0000269|PubMed:18390730,
ECO:0000269|PubMed:20935647}. Secreted
{ECO:0000269|PubMed:11145836, ECO:0000269|PubMed:18390730}.
Note=Stimulation with IL1B leads to colocalization with SMAD3
mostly in perinuclear regions (PubMed:20935647). Only the CASP1-
cleaved mature form translocates into the nucleus upon LPS
stimulation (PubMed:18390730).
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=B; Synonyms=IL-1F7b, IL-HLa;
IsoId=Q9NZH6-1; Sequence=Displayed;
Note=The name IL-HL refers to isoform B containing polymorphisms
Val-31 and Ala-42. {ECO:0000305|PubMed:11145836};
Name=A;
IsoId=Q9NZH6-2; Sequence=VSP_002653;
Name=C; Synonyms=IL-HS;
IsoId=Q9NZH6-3; Sequence=VSP_002656;
Name=D; Synonyms=IL1F7d;
IsoId=Q9NZH6-4; Sequence=VSP_002654;
Name=E; Synonyms=IL1F7e;
IsoId=Q9NZH6-5; Sequence=VSP_002655;
-!- TISSUE SPECIFICITY: In general, low constitutive expression, if
any, in healthy tissues; high expression in inflammatory
counterparts, including in synovial tissues from individuals with
active rheumatoid arthritis. Isoform A, isoform B and isoform C
are expressed in testis, colon, placenta, lung and lymph node.
Isoform D and isoform E were found only in testis and bone marrow.
Whereas only isoform A is found in brain, only isoform B in kidney
and only isoform C in heart. {ECO:0000269|PubMed:11145836,
ECO:0000269|PubMed:20935647}.
-!- INDUCTION: Highly induced by bacterial lipopolysaccharides (LPS)
and TGFB1, more moderately by IFNG, IL18, IL1B, TNF and the
dinucleotide CpG (at protein level). Constitutive expression in
bone marrow macrophages is down-regulated in the presence of IL4
and CSF2. Induced by phorbol myristate acetate (PMA) in different
cell lines. {ECO:0000269|PubMed:18390730,
ECO:0000269|PubMed:20935647}.
-!- PTM: Proteolytically converted to the mature form by CASP1.
-!- SIMILARITY: Belongs to the IL-1 family. {ECO:0000305}.
-!- WEB RESOURCE: Name=Wikipedia; Note=Interleukin-1 entry;
URL="https://en.wikipedia.org/wiki/Interleukin_1";
-!- WEB RESOURCE: Name=SeattleSNPs;
URL="http://pga.gs.washington.edu/data/il1f7/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF200496; AAF69252.1; -; mRNA.
EMBL; AF167368; AAG29344.1; -; mRNA.
EMBL; AF251118; AAG14420.1; -; mRNA.
EMBL; AF251119; AAG14421.1; -; mRNA.
EMBL; AF251120; AAG14422.1; -; mRNA.
EMBL; AF201832; AAF25212.1; -; mRNA.
EMBL; AY071840; AAL67151.1; -; mRNA.
EMBL; AY071841; AAL67154.1; -; mRNA.
EMBL; AY973625; AAX59036.1; -; Genomic_DNA.
EMBL; AB451333; BAG70147.1; -; mRNA.
EMBL; AB451478; BAG70292.1; -; mRNA.
EMBL; AC079753; AAX88889.1; -; Genomic_DNA.
EMBL; CH471217; EAW73609.1; -; Genomic_DNA.
EMBL; BC020637; AAH20637.1; -; mRNA.
CCDS; CCDS2103.1; -. [Q9NZH6-1]
CCDS; CCDS2104.1; -. [Q9NZH6-4]
CCDS; CCDS2105.1; -. [Q9NZH6-5]
CCDS; CCDS2106.1; -. [Q9NZH6-3]
CCDS; CCDS2107.1; -. [Q9NZH6-2]
RefSeq; NP_055254.2; NM_014439.3. [Q9NZH6-1]
RefSeq; NP_775294.1; NM_173202.1. [Q9NZH6-4]
RefSeq; NP_775295.1; NM_173203.1. [Q9NZH6-5]
RefSeq; NP_775296.1; NM_173204.1. [Q9NZH6-3]
RefSeq; NP_775297.1; NM_173205.1. [Q9NZH6-2]
RefSeq; XP_011509265.1; XM_011510963.2. [Q9NZH6-1]
RefSeq; XP_011509266.1; XM_011510964.2. [Q9NZH6-3]
UniGene; Hs.166371; -.
PDB; 5HN1; X-ray; 2.25 A; A/B=46-218.
PDBsum; 5HN1; -.
ProteinModelPortal; Q9NZH6; -.
SMR; Q9NZH6; -.
BioGrid; 118054; 12.
IntAct; Q9NZH6; 3.
MINT; MINT-1208512; -.
STRING; 9606.ENSP00000263326; -.
PhosphoSitePlus; Q9NZH6; -.
BioMuta; IL37; -.
DMDM; 25008593; -.
PaxDb; Q9NZH6; -.
PeptideAtlas; Q9NZH6; -.
PRIDE; Q9NZH6; -.
DNASU; 27178; -.
Ensembl; ENST00000263326; ENSP00000263326; ENSG00000125571. [Q9NZH6-1]
Ensembl; ENST00000311328; ENSP00000309883; ENSG00000125571. [Q9NZH6-2]
Ensembl; ENST00000349806; ENSP00000263328; ENSG00000125571. [Q9NZH6-5]
Ensembl; ENST00000352179; ENSP00000263327; ENSG00000125571. [Q9NZH6-4]
Ensembl; ENST00000353225; ENSP00000309208; ENSG00000125571. [Q9NZH6-3]
GeneID; 27178; -.
KEGG; hsa:27178; -.
UCSC; uc002tij.4; human. [Q9NZH6-1]
CTD; 27178; -.
DisGeNET; 27178; -.
GeneCards; IL37; -.
HGNC; HGNC:15563; IL37.
HPA; HPA054371; -.
HPA; HPA057950; -.
MIM; 605510; gene.
neXtProt; NX_Q9NZH6; -.
OpenTargets; ENSG00000125571; -.
PharmGKB; PA38390; -.
eggNOG; ENOG410J8RD; Eukaryota.
eggNOG; ENOG41118IW; LUCA.
GeneTree; ENSGT00530000062899; -.
HOVERGEN; HBG052101; -.
InParanoid; Q9NZH6; -.
KO; K05485; -.
OMA; RKHTEFS; -.
OrthoDB; EOG091G0J3H; -.
PhylomeDB; Q9NZH6; -.
TreeFam; TF300203; -.
Reactome; R-HSA-449836; Other interleukin signaling.
GeneWiki; IL1F7; -.
GenomeRNAi; 27178; -.
PMAP-CutDB; Q9NZH6; -.
PRO; PR:Q9NZH6; -.
Proteomes; UP000005640; Chromosome 2.
Bgee; ENSG00000125571; -.
CleanEx; HS_IL1F7; -.
Genevisible; Q9NZH6; HS.
GO; GO:0005829; C:cytosol; IEA:UniProtKB-SubCell.
GO; GO:0005576; C:extracellular region; TAS:UniProtKB.
GO; GO:0005615; C:extracellular space; IBA:GO_Central.
GO; GO:0043231; C:intracellular membrane-bounded organelle; IDA:HPA.
GO; GO:0005654; C:nucleoplasm; IDA:HPA.
GO; GO:0005125; F:cytokine activity; IBA:GO_Central.
GO; GO:0005149; F:interleukin-1 receptor binding; TAS:UniProtKB.
GO; GO:0019221; P:cytokine-mediated signaling pathway; IBA:GO_Central.
GO; GO:0006955; P:immune response; NAS:UniProtKB.
GO; GO:0006954; P:inflammatory response; IEA:InterPro.
InterPro; IPR000975; IL-1_fam.
InterPro; IPR003297; IL-1RA/IL-36.
InterPro; IPR027169; IL-37.
InterPro; IPR008996; IL1/FGF.
PANTHER; PTHR10078:SF65; PTHR10078:SF65; 1.
Pfam; PF00340; IL1; 1.
PRINTS; PR00264; INTERLEUKIN1.
PRINTS; PR01360; INTRLEUKIN1X.
SUPFAM; SSF50353; SSF50353; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Complete proteome; Cytokine;
Cytoplasm; Direct protein sequencing; Nucleus; Polymorphism;
Reference proteome; Secreted.
PROPEP 1 45 Removed in mature form.
{ECO:0000269|PubMed:11145836}.
/FTId=PRO_0000015335.
CHAIN 46 218 Interleukin-37.
/FTId=PRO_0000015336.
VAR_SEQ 1 49 MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLP
TMNFVHTS -> MSGCDRRETETKGKNSFKKRLRG (in
isoform A).
{ECO:0000303|PubMed:10625660}.
/FTId=VSP_002653.
VAR_SEQ 28 88 Missing (in isoform E).
{ECO:0000303|PubMed:11991723}.
/FTId=VSP_002655.
VAR_SEQ 28 49 DPAGSPLEPGPSLPTMNFVHTS -> G (in isoform
D). {ECO:0000303|PubMed:11991723,
ECO:0000303|PubMed:19054851}.
/FTId=VSP_002654.
VAR_SEQ 49 89 SPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPE
-> K (in isoform C).
{ECO:0000303|PubMed:11145836}.
/FTId=VSP_002656.
VARIANT 31 31 G -> V (in dbSNP:rs3811046).
{ECO:0000269|PubMed:11145836,
ECO:0000269|PubMed:15489334,
ECO:0000269|Ref.6}.
/FTId=VAR_014260.
VARIANT 42 42 T -> A (in dbSNP:rs3811047).
{ECO:0000269|PubMed:11145836,
ECO:0000269|PubMed:15489334,
ECO:0000269|Ref.6}.
/FTId=VAR_014261.
VARIANT 50 50 P -> R (in dbSNP:rs2708943).
/FTId=VAR_049574.
VARIANT 54 54 N -> S (in dbSNP:rs2723183).
/FTId=VAR_049575.
VARIANT 108 108 P -> L (in dbSNP:rs2723187).
{ECO:0000269|Ref.6}.
/FTId=VAR_023334.
VARIANT 152 152 R -> W (in dbSNP:rs28947200).
{ECO:0000269|Ref.6}.
/FTId=VAR_023335.
VARIANT 164 164 W -> R (in dbSNP:rs2708947).
{ECO:0000269|Ref.6}.
/FTId=VAR_023336.
VARIANT 218 218 D -> N (in dbSNP:rs2723192).
{ECO:0000269|Ref.6}.
/FTId=VAR_023337.
STRAND 58 73 {ECO:0000244|PDB:5HN1}.
STRAND 76 81 {ECO:0000244|PDB:5HN1}.
STRAND 91 95 {ECO:0000244|PDB:5HN1}.
STRAND 107 113 {ECO:0000244|PDB:5HN1}.
TURN 114 117 {ECO:0000244|PDB:5HN1}.
STRAND 118 123 {ECO:0000244|PDB:5HN1}.
STRAND 132 137 {ECO:0000244|PDB:5HN1}.
HELIX 140 144 {ECO:0000244|PDB:5HN1}.
HELIX 148 151 {ECO:0000244|PDB:5HN1}.
HELIX 152 154 {ECO:0000244|PDB:5HN1}.
STRAND 156 161 {ECO:0000244|PDB:5HN1}.
STRAND 164 172 {ECO:0000244|PDB:5HN1}.
STRAND 176 178 {ECO:0000244|PDB:5HN1}.
STRAND 181 186 {ECO:0000244|PDB:5HN1}.
STRAND 188 191 {ECO:0000244|PDB:5HN1}.
HELIX 196 198 {ECO:0000244|PDB:5HN1}.
STRAND 201 205 {ECO:0000244|PDB:5HN1}.
SEQUENCE 218 AA; 24126 MW; 96E089310D2CEA68 CRC64;
MSFVGENSGV KMGSEDWEKD EPQCCLEDPA GSPLEPGPSL PTMNFVHTSP KVKNLNPKKF
SIHDQDHKVL VLDSGNLIAV PDKNYIRPEI FFALASSLSS ASAEKGSPIL LGVSKGEFCL
YCDKDKGQSH PSLQLKKEKL MKLAAQKESA RRPFIFYRAQ VGSWNMLESA AHPGWFICTS
CNCNEPVGVT DKFENRKHIE FSFQPVCKAE MSPSEVSD


Related products :

Catalog number Product name Quantity
E2205h Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interleukin-36 ga
E2205h ELISA Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interleukin 96T
U2205h CLIA Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interleukin- 96T
E2205h ELISA kit Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interl 96T
U2205h CLIA kit Homo sapiens,Human,IL-1 epsilon,IL1E,IL1F9,IL-1F9,IL1H1,IL-1H1,IL-1-related protein 2,IL1RP2,IL-1RP2,IL36G,Interleukin-1 epsilon,Interleukin-1 family member 9,Interleukin-1 homolog 1,Interle 96T
orb82722 Human IL1 RN protein Recombinant Human Interleukin-1 Receptor Antagonist is a member of the Interleukin-1cytokine family. IL1RN inhibits the activities of Interleukin-1 alpha (IL1A) and Interleukin-1 1 mg
IL1F9 IL1F7 Gene interleukin 1 family, member 7 (zeta)
201-20-2760 IL1F7{interleukin 1 family, member 7 (zeta)}rabbit.pAb 0.2ml
26-207 IL1RAPL2 is a member of the interleukin 1 receptor family. This protein is similar to the interleukin 1 accessory proteins, and is most closely related to interleukin 1 receptor accessory protein-like 0.05 mg
18-321-177008 INTERLEUKIN 6 CROSS REACTIVE WITH RAT INTERLEUKIN 6 - POLYCLONAL ANTIBODY TO MOUSE INTERLEUKIN 6 CROSS REACTIVE WITH RAT INTERLEUKIN 6; IL-6; Interleukin HP-1; B-cell hybridoma growth factor Polyclona 0.1 mg
E0065h ELISA kit CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 r 96T
E0066h ELISA kit CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 recepto 96T
U0065h CLIA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recepto 96T
E0065h ELISA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recept 96T
E0066h ELISA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor typ 96T
E2103h ELISA kit Cytokine Zcyto7,Homo sapiens,Human,IL17B,IL-17B,IL20,IL-20,Interleukin-17B,Interleukin-20,Neuronal interleukin-17-related factor,NIRF,UNQ516_PRO1031,ZCYTO7 96T
U2103h CLIA kit Cytokine Zcyto7,Homo sapiens,Human,IL17B,IL-17B,IL20,IL-20,Interleukin-17B,Interleukin-20,Neuronal interleukin-17-related factor,NIRF,UNQ516_PRO1031,ZCYTO7 96T
U2103h CLIA Cytokine Zcyto7,Homo sapiens,Human,IL17B,IL-17B,IL20,IL-20,Interleukin-17B,Interleukin-20,Neuronal interleukin-17-related factor,NIRF,UNQ516_PRO1031,ZCYTO7 96T
E2103h ELISA Cytokine Zcyto7,Homo sapiens,Human,IL17B,IL-17B,IL20,IL-20,Interleukin-17B,Interleukin-20,Neuronal interleukin-17-related factor,NIRF,UNQ516_PRO1031,ZCYTO7 96T
E2205m Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus
U2205m CLIA Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
E2205m ELISA kit Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
E2205m ELISA Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
U2205m CLIA kit Il1f9,IL-1F9,Il36g,Interleukin-1 family member 9,Interleukin-36 gamma,Mouse,Mus musculus 96T
U0066h CLIA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur