Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

KH domain-containing protein akap-1

 AKAP1_CAEEL             Reviewed;         867 AA.
Q09285; Q09286;
01-NOV-1997, integrated into UniProtKB/Swiss-Prot.
25-NOV-2002, sequence version 2.
07-NOV-2018, entry version 121.
RecName: Full=KH domain-containing protein akap-1 {ECO:0000305};
Name=akap-1 {ECO:0000312|WormBase:C56G2.1a};
ORFNames=C56G2.1 {ECO:0000312|WormBase:C56G2.1a};
Caenorhabditis elegans.
Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
Caenorhabditis.
NCBI_TaxID=6239;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], AND ALTERNATIVE
SPLICING.
STRAIN=Bristol N2;
PubMed=9851916; DOI=10.1126/science.282.5396.2012;
The C. elegans sequencing consortium;
"Genome sequence of the nematode C. elegans: a platform for
investigating biology.";
Science 282:2012-2018(1998).
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000255}; Single-pass membrane
protein {ECO:0000255}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=a;
IsoId=Q09285-1; Sequence=Displayed;
Name=b;
IsoId=Q09285-2; Sequence=VSP_002856, VSP_002857;
Note=No experimental confirmation available.;
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; FO080744; CCD66341.1; -; Genomic_DNA.
EMBL; FO080744; CCD66342.1; -; Genomic_DNA.
RefSeq; NP_741190.1; NM_171163.5. [Q09285-1]
RefSeq; NP_741191.1; NM_171164.4. [Q09285-2]
UniGene; Cel.38678; -.
ProteinModelPortal; Q09285; -.
SMR; Q09285; -.
STRING; 6239.C56G2.1a; -.
iPTMnet; Q09285; -.
EPD; Q09285; -.
PaxDb; Q09285; -.
PeptideAtlas; Q09285; -.
PRIDE; Q09285; -.
EnsemblMetazoa; C56G2.1a; C56G2.1a; WBGene00016977. [Q09285-1]
EnsemblMetazoa; C56G2.1b.1; C56G2.1b.1; WBGene00016977. [Q09285-2]
EnsemblMetazoa; C56G2.1b.2; C56G2.1b.2; WBGene00016977. [Q09285-2]
GeneID; 175898; -.
KEGG; cel:CELE_C56G2.1; -.
CTD; 175898; -.
WormBase; C56G2.1a; CE24866; WBGene00016977; akap-1. [Q09285-1]
WormBase; C56G2.1b; CE30637; WBGene00016977; akap-1. [Q09285-2]
eggNOG; KOG2279; Eukaryota.
eggNOG; ENOG410Z0DP; LUCA.
GeneTree; ENSGT00390000001360; -.
HOGENOM; HOG000018740; -.
InParanoid; Q09285; -.
KO; K16518; -.
OMA; ICAVEGS; -.
OrthoDB; EOG091G0SWL; -.
Reactome; R-CEL-983231; Factors involved in megakaryocyte development and platelet production.
PRO; PR:Q09285; -.
Proteomes; UP000001940; Chromosome III.
Bgee; WBGene00016977; Expressed in 6 organ(s), highest expression level in material anatomical entity.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005739; C:mitochondrion; IEA:InterPro.
GO; GO:0034237; F:protein kinase A regulatory subunit binding; IEA:InterPro.
GO; GO:0003723; F:RNA binding; IEA:UniProtKB-KW.
GO; GO:0010738; P:regulation of protein kinase A signaling; IEA:InterPro.
Gene3D; 2.40.50.90; -; 1.
Gene3D; 3.30.1370.10; -; 1.
InterPro; IPR033104; Akap1.
InterPro; IPR004087; KH_dom.
InterPro; IPR004088; KH_dom_type_1.
InterPro; IPR036612; KH_dom_type_1_sf.
InterPro; IPR035437; SNase_OB-fold_sf.
InterPro; IPR002999; Tudor.
PANTHER; PTHR22948:SF18; PTHR22948:SF18; 1.
Pfam; PF00013; KH_1; 1.
Pfam; PF00567; TUDOR; 1.
SMART; SM00322; KH; 1.
SMART; SM00333; TUDOR; 1.
SUPFAM; SSF54791; SSF54791; 1.
PROSITE; PS50084; KH_TYPE_1; 1.
PROSITE; PS50304; TUDOR; 1.
3: Inferred from homology;
Alternative splicing; Complete proteome; Membrane; Reference proteome;
RNA-binding; Transmembrane; Transmembrane helix.
CHAIN 1 867 KH domain-containing protein akap-1.
{ECO:0000305}.
/FTId=PRO_0000050163.
TRANSMEM 108 128 Helical. {ECO:0000255}.
DOMAIN 528 595 KH. {ECO:0000255|PROSITE-
ProRule:PRU00117}.
DOMAIN 689 747 Tudor. {ECO:0000255|PROSITE-
ProRule:PRU00211}.
COMPBIAS 3 12 Poly-Ala. {ECO:0000255}.
VAR_SEQ 1 458 Missing (in isoform b). {ECO:0000305}.
/FTId=VSP_002856.
VAR_SEQ 459 500 VLKHHENEAGDAAHAQIIESPHHENASYEKSDSPGLDSQNS
E -> MKVYAKVQEEVKTRRLRKNSTTSSGYGYSVPMTPNT
EILFDT (in isoform b). {ECO:0000305}.
/FTId=VSP_002857.
SEQUENCE 867 AA; 96430 MW; 1F3083DB0EBFE844 CRC64;
MVAAAAADAL AAGGDSSSPS DLYNKITGQQ SSTTTSLSYA ACDVITRHLI SMLLEISNWT
NDLAKYLAGS EQSSDDGHNE RCLLFSSIFF AIDPSLALAQ MSSVASKHAL LIALGGFSIA
ALFVWYINKK DKDGRKKKKV GDVISNGLPK TATASDVQTE NGNVKKANGH VNGDVQSSIG
VSQKQQQKDE DEKTQKKDAV QNEKPSIDKK QPKSQAPTEK KEEKTVEIHT ETEETDHVAA
GDSGVVSEHK EHDKKTKQKN DEPVSIDKKS EEIEVPKQAG VVNEEPKKQS EETVVEEQFV
KKEEPKLKSA PTPLLTMPSK KKVLENEQIP EEPTPTKMND ATSPLSLDIA AQMSPASFSW
SEEMEKSFNE EEFRLNESSD IDRSPASPLR HLQQQHNKNR SSQKRKGGRV NGRDGVHQPQ
QQHQQQKKEE QGQIKKGQRR LTKEKSVEET PEKSQKRVVL KHHENEAGDA AHAQIIESPH
HENASYEKSD SPGLDSQNSE ASSQDSGRAT GPLASPHEDG LTTEDDFLPM YEFEIPNSLV
GLIIGVKGKT IKELSVRTNV RMLIRQHHET DKVKTHQICQ VRGKRDEINH CLQMLRRRFP
PARFPELNLQ PVVPPVLPNS NFDMLSTQPT WLTLPEDIKC EVAVSSIISA SHFFIQQPTH
PSFASLRHLD MYMGSLYGEQ SNLPELPIPC QNGLLCAAPV GNAWFRAVTV QYFDETDEVF
VKFVDYGGYS KMARQDLRQI RTDLMSLPFQ STEVMLAHVR PVDGTTNWSD AAMQKFRAMC
IGKVINCKMV GQSHDTRIPM VELYMMSKDG KDAQEVRFDQ VLMNCGLART ADPSKMSRIT
VPAALDTESR MKRPSFSSQT SQTAVVC


Related products :

Catalog number Product name Quantity
EIAAB39592 A-kinase anchor protein SPHKAP,Kiaa1678,Mouse,Mus musculus,SPHK1-interactor and AKAP domain-containing protein,Sphkap
EIAAB39593 A-kinase anchor protein SPHKAP,Rat,Rattus norvegicus,Skip,Sphingosine kinase type 1-interacting protein,SPHK1-interactor and AKAP domain-containing protein,Sphkap
EIAAB39594 A-kinase anchor protein SPHKAP,Homo sapiens,Human,KIAA1678,SKIP,Sphingosine kinase type 1-interacting protein,SPHK1-interactor and AKAP domain-containing protein,SPHKAP
CSB-EL022566RA Rat SPHK1 interactor, AKAP domain containing (SPHKAP) ELISA kit, Species Rat, Sample Type serum, plasma 96T
SPHKAP SPHKAP Gene SPHK1 interactor, AKAP domain containing
EIAAB35706 AKAP-associated sperm protein,ASP,Homo sapiens,Human,ROPN1L,ROPN1-like protein,Ropporin-1-like protein
CSB-EL022566HU Human SPHK1 interactor, AKAP domain containing (SPHKAP) ELISA kit, Species Human, Sample Type serum, plasma 96T
CSB-EL022566MO Mouse SPHK1 interactor, AKAP domain containing (SPHKAP) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
EIAAB35707 AKAP-associated sperm protein,Asp,Mouse,Mus musculus,Ropn1l,Ropporin-1-like protein
bs-7903R Rabbit Anti-AKAP associated Sperm Protein Polyclonal Antibody 100ul
bs-7903R-Cy5.5 Rabbit Anti-AKAP associated Sperm Protein Polyclonal Antibody, Cy5.5 Conjugated 100ul
bs-7903R-Cy5 Rabbit Anti-AKAP associated Sperm Protein Polyclonal Antibody, Cy5 Conjugated 100ul
bs-7903R-Cy7 Rabbit Anti-AKAP associated Sperm Protein Polyclonal Antibody, Cy7 Conjugated 100ul
bs-7903R-Cy3 Rabbit Anti-AKAP associated Sperm Protein Polyclonal Antibody, Cy3 Conjugated 100ul
bs-7903R-A488 Rabbit Anti-AKAP associated Sperm Protein Polyclonal Antibody, ALEXA FLUOR 488 Conjugated 100ul
bs-7903R-A555 Rabbit Anti-AKAP associated Sperm Protein Polyclonal Antibody, ALEXA FLUOR 555 Conjugated 100ul
bs-7903R-A350 Rabbit Anti-AKAP associated Sperm Protein Polyclonal Antibody, ALEXA FLUOR 350 Conjugated 100ul
bs-7903R-A647 Rabbit Anti-AKAP associated Sperm Protein Polyclonal Antibody, ALEXA FLUOR 647 Conjugated 100ul
28-476 AKAP7 encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and ta 0.1 mg
28-477 AKAP7 is a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target 0.1 mg
28-478 AKAP7 is a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target 0.05 mg
bs-7903R-FITC Rabbit Anti-AKAP associated Sperm Protein Polyclonal Antibody, FITC Conjugated 100ul
bs-7903R-Biotin Rabbit Anti-AKAP associated Sperm Protein Polyclonal Antibody, Biotin Conjugated 100ul
18-783-78523 GOAT ANTI HUMAN GRAVIN - A-kinase anchor protein 250 kDa; AKAP 250; Gravin; Myasthenia gravis autoantigen Polyclonal 0.1 mg
28-082 LIM domain only 6 is a three LIM domain-containing protein. The LIM domain is a cysteine-rich sequence motif that binds zinc atoms to form a specific protein-binding interface for protein-protein inte 0.05 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur | Gentaur





GENTAUR Ltd.
Unicorn House, Station Cl
Hertfordshire, Potters Bar EN6 1TL
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017
RIB 30004 00187 00010092253 10
BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG
IBAN FR76 3000 4001 8700 0100 9225 310
france@gentaur.com | Gentaur | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: +49 0241 40 08 90 86, +49 0241 95 78 94 78, +49 0241 40 08 90 86
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur | Gentaur