Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Krueppel-like factor 10 (EGR-alpha) (Transforming growth factor-beta-inducible early growth response protein 1) (TGFB-inducible early growth response protein 1) (TIEG-1)

 KLF10_HUMAN             Reviewed;         480 AA.
Q13118; A8MVH0; B2R794; L0R4P6; L0R679; O75411; Q503B2;
01-DEC-2000, integrated into UniProtKB/Swiss-Prot.
01-NOV-1996, sequence version 1.
25-OCT-2017, entry version 169.
RecName: Full=Krueppel-like factor 10;
AltName: Full=EGR-alpha;
AltName: Full=Transforming growth factor-beta-inducible early growth response protein 1;
Short=TGFB-inducible early growth response protein 1;
Short=TIEG-1;
Name=KLF10; Synonyms=TIEG, TIEG1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), AND FUNCTION.
PubMed=8584037; DOI=10.1210/mend.9.11.8584037;
Blok L.J., Grossmann M.E., Perry J.E., Tindall D.J.;
"Characterization of an early growth response gene, which encodes a
zinc finger transcription factor, potentially involved in cell cycle
regulation.";
Mol. Endocrinol. 9:1610-1620(1995).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND INDUCTION.
PubMed=8532536; DOI=10.1093/nar/23.23.4907;
Subramaniam M., Harris S.A., Oursler M.J., Rasmussen K., Riggs B.L.,
Spelsberg T.C.;
"Identification of a novel TGF-beta-regulated gene encoding a putative
zinc finger protein in human osteoblasts.";
Nucleic Acids Res. 23:4907-4912(1995).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=9721211; DOI=10.1006/geno.1998.5388;
Fautsch M.P., Vrabel A., Subramaniam M., Hefferen T.E.,
Spelsberg T.C., Wieben E.D.;
"TGFbeta-inducible early gene (TIEG) also codes for early growth
response alpha (EGRalpha): evidence of multiple transcripts from
alternate promoters.";
Genomics 51:408-416(1998).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), AND ALTERNATIVE
SPLICING.
PubMed=23134681; DOI=10.1096/fj.12-220319;
Camacho-Vanegas O., Till J., Miranda-Lorenzo I., Ozturk B.,
Camacho S.C., Martignetti J.A.;
"Shaking the family tree: Identification of novel and biologically
active alternatively spliced isoforms across the KLF family of
transcription factors.";
FASEB J. 27:432-436(2013).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
Phelan M., Farmer A.;
"Cloning of human full-length CDSs in BD Creator(TM) system donor
vector.";
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Amygdala;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16421571; DOI=10.1038/nature04406;
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S.,
Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A.,
Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X.,
Allen N.R., Anderson S., Asakawa T., Blechschmidt K., Bloom T.,
Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K.,
DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G.,
Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B.,
Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P.,
Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H.,
Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C.,
O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K.,
Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R.,
Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K.,
Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q.,
Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N.,
Lander E.S.;
"DNA sequence and analysis of human chromosome 8.";
Nature 439:331-335(2006).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
TISSUE=Eye, and Placenta;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[10]
INTERACTION WITH SIAH1, UBIQUITINATION, AND PROTEASOMAL DEGRADATION.
PubMed=12072443; DOI=10.1074/jbc.M204812200;
Johnsen S.A., Subramaniam M., Monroe D.G., Janknecht R.,
Spelsberg T.C.;
"Modulation of transforming growth factor beta (TGFbeta)/Smad
transcriptional responses through targeted degradation of TGFbeta-
inducible early gene-1 by human seven in absentia homologue.";
J. Biol. Chem. 277:30754-30759(2002).
[11]
DNA-BINDING.
PubMed=12804117; DOI=10.1089/104454903321655819;
Chrisman H.R., Tindall D.J.;
"Identification and characterization of a consensus DNA binding
element for the zinc finger transcription factor TIEG/EGRalpha.";
DNA Cell Biol. 22:187-199(2003).
[12]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-249, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[13]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-184, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[14]
STRUCTURE BY NMR OF 353-423.
RIKEN structural genomics initiative (RSGI);
"Solution structure of the first and second ZF-C2H2 domains from human
krueppel-like factor 10.";
Submitted (APR-2008) to the PDB data bank.
-!- FUNCTION: Transcriptional repressor which binds to the consensus
sequence 5'-GGTGTG-3'. Plays a role in the regulation of the
circadian clock; binds to the GC box sequence in the promoter of
the core clock component ARTNL/BMAL1 and represses its
transcriptional activity. Regulates the circadian expression of
genes involved in lipogenesis, gluconeogenesis, and glycolysis in
the liver. Represses the expression of PCK2, a rate-limiting step
enzyme of gluconeogenesis (By similarity). May play a role in the
cell cycle regulation. {ECO:0000250|UniProtKB:O89091,
ECO:0000269|PubMed:8584037}.
-!- INTERACTION:
P08047:SP1; NbExp=2; IntAct=EBI-1389509, EBI-298336;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:O89091}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1;
IsoId=Q13118-1; Sequence=Displayed;
Name=2;
IsoId=Q13118-2; Sequence=VSP_042653;
Note=No experimental confirmation available.;
Name=3;
IsoId=Q13118-3; Sequence=VSP_042653, VSP_047483, VSP_047484;
Name=4;
IsoId=Q13118-4; Sequence=VSP_042653, VSP_047482, VSP_047485;
-!- INDUCTION: By TGFB1 and BMP2. {ECO:0000269|PubMed:8532536}.
-!- PTM: Ubiquitinated; mediated by SIAH1 and leading to its
subsequent proteasomal degradation. {ECO:0000269|PubMed:12072443}.
-!- SIMILARITY: Belongs to the Sp1 C2H2-type zinc-finger protein
family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; S81439; AAB36088.1; -; mRNA.
EMBL; U21847; AAC50340.1; -; mRNA.
EMBL; AF050110; AAC34293.1; -; Genomic_DNA.
EMBL; AF050110; AAC34294.1; -; Genomic_DNA.
EMBL; HF546210; CCO02796.1; -; mRNA.
EMBL; HF546211; CCO02797.1; -; mRNA.
EMBL; BT006634; AAP35280.1; -; mRNA.
EMBL; AK312894; BAG35741.1; -; mRNA.
EMBL; AP002851; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471060; EAW91850.1; -; Genomic_DNA.
EMBL; BC011538; AAH11538.1; -; mRNA.
EMBL; BC095399; AAH95399.1; -; mRNA.
CCDS; CCDS47905.1; -. [Q13118-2]
CCDS; CCDS6294.1; -. [Q13118-1]
RefSeq; NP_001027453.1; NM_001032282.3. [Q13118-2]
RefSeq; NP_005646.1; NM_005655.3. [Q13118-1]
UniGene; Hs.435001; -.
PDB; 2EPA; NMR; -; A=359-423.
PDBsum; 2EPA; -.
ProteinModelPortal; Q13118; -.
SMR; Q13118; -.
BioGrid; 112927; 19.
CORUM; Q13118; -.
ELM; Q13118; -.
IntAct; Q13118; 17.
MINT; MINT-144333; -.
STRING; 9606.ENSP00000285407; -.
BindingDB; Q13118; -.
ChEMBL; CHEMBL3407312; -.
iPTMnet; Q13118; -.
PhosphoSitePlus; Q13118; -.
DMDM; 11387050; -.
MaxQB; Q13118; -.
PaxDb; Q13118; -.
PeptideAtlas; Q13118; -.
PRIDE; Q13118; -.
TopDownProteomics; Q13118-1; -. [Q13118-1]
DNASU; 7071; -.
Ensembl; ENST00000285407; ENSP00000285407; ENSG00000155090. [Q13118-1]
Ensembl; ENST00000395884; ENSP00000379222; ENSG00000155090. [Q13118-2]
GeneID; 7071; -.
KEGG; hsa:7071; -.
UCSC; uc011lhj.3; human. [Q13118-1]
CTD; 7071; -.
DisGeNET; 7071; -.
EuPathDB; HostDB:ENSG00000155090.14; -.
GeneCards; KLF10; -.
HGNC; HGNC:11810; KLF10.
MIM; 601878; gene.
neXtProt; NX_Q13118; -.
OpenTargets; ENSG00000155090; -.
PharmGKB; PA36517; -.
eggNOG; KOG1721; Eukaryota.
eggNOG; COG5048; LUCA.
GeneTree; ENSGT00760000118984; -.
HOGENOM; HOG000059558; -.
HOVERGEN; HBG052264; -.
InParanoid; Q13118; -.
KO; K09209; -.
OMA; KPHIAAP; -.
OrthoDB; EOG091G1BN0; -.
PhylomeDB; Q13118; -.
TreeFam; TF315506; -.
SIGNOR; Q13118; -.
EvolutionaryTrace; Q13118; -.
GeneWiki; KLF10; -.
GenomeRNAi; 7071; -.
PRO; PR:Q13118; -.
Proteomes; UP000005640; Chromosome 8.
Bgee; ENSG00000155090; -.
CleanEx; HS_KLF10; -.
Genevisible; Q13118; HS.
GO; GO:0005634; C:nucleus; ISS:UniProtKB.
GO; GO:0001046; F:core promoter sequence-specific DNA binding; ISS:UniProtKB.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0000978; F:RNA polymerase II core promoter proximal region sequence-specific DNA binding; IDA:NTNU_SB.
GO; GO:0003700; F:transcription factor activity, sequence-specific DNA binding; TAS:ProtInc.
GO; GO:0001077; F:transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding; IDA:NTNU_SB.
GO; GO:0030282; P:bone mineralization; IEA:Ensembl.
GO; GO:0008283; P:cell proliferation; TAS:ProtInc.
GO; GO:0007267; P:cell-cell signaling; TAS:ProtInc.
GO; GO:1901653; P:cellular response to peptide; IEA:Ensembl.
GO; GO:0009267; P:cellular response to starvation; ISS:UniProtKB.
GO; GO:0007623; P:circadian rhythm; IEA:Ensembl.
GO; GO:0008285; P:negative regulation of cell proliferation; TAS:ProtInc.
GO; GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; TAS:ProtInc.
GO; GO:0045892; P:negative regulation of transcription, DNA-templated; ISS:UniProtKB.
GO; GO:0045672; P:positive regulation of osteoclast differentiation; IEA:Ensembl.
GO; GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; IDA:NTNU_SB.
GO; GO:0042752; P:regulation of circadian rhythm; ISS:UniProtKB.
GO; GO:0001501; P:skeletal system development; TAS:ProtInc.
GO; GO:0035019; P:somatic stem cell population maintenance; IEA:Ensembl.
GO; GO:0007179; P:transforming growth factor beta receptor signaling pathway; TAS:ProtInc.
Gene3D; 3.30.40.10; -; 1.
InterPro; IPR036236; Znf_C2H2_sf.
InterPro; IPR013087; Znf_C2H2_type.
InterPro; IPR013083; Znf_RING/FYVE/PHD.
SMART; SM00355; ZnF_C2H2; 3.
SUPFAM; SSF57667; SSF57667; 2.
PROSITE; PS00028; ZINC_FINGER_C2H2_1; 3.
PROSITE; PS50157; ZINC_FINGER_C2H2_2; 3.
1: Evidence at protein level;
3D-structure; Alternative splicing; Biological rhythms;
Complete proteome; DNA-binding; Metal-binding; Nucleus;
Phosphoprotein; Polymorphism; Reference proteome; Repeat; Repressor;
Transcription; Transcription regulation; Ubl conjugation; Zinc;
Zinc-finger.
CHAIN 1 480 Krueppel-like factor 10.
/FTId=PRO_0000047177.
ZN_FING 369 393 C2H2-type 1. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
ZN_FING 399 423 C2H2-type 2. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
ZN_FING 429 451 C2H2-type 3. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
MOD_RES 184 184 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 249 249 Phosphoserine.
{ECO:0000244|PubMed:18669648}.
VAR_SEQ 1 12 MLNFGASLQQTA -> M (in isoform 2, isoform
3 and isoform 4).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:23134681,
ECO:0000303|PubMed:8584037,
ECO:0000303|Ref.5}.
/FTId=VSP_042653.
VAR_SEQ 91 134 CLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIA
APF -> EKSLSAVAGKVVKGGLPVLMNCPDTGEPTRVRRN
LRAPCVTGGS (in isoform 4).
{ECO:0000303|PubMed:23134681}.
/FTId=VSP_047482.
VAR_SEQ 91 102 CLTPPYSPSDFE -> QQKSLLRLIHQG (in isoform
3). {ECO:0000303|PubMed:23134681}.
/FTId=VSP_047483.
VAR_SEQ 103 480 Missing (in isoform 3).
{ECO:0000303|PubMed:23134681}.
/FTId=VSP_047484.
VAR_SEQ 135 480 Missing (in isoform 4).
{ECO:0000303|PubMed:23134681}.
/FTId=VSP_047485.
VARIANT 249 249 S -> F (in dbSNP:rs4734653).
/FTId=VAR_052716.
TURN 374 376 {ECO:0000244|PDB:2EPA}.
STRAND 379 382 {ECO:0000244|PDB:2EPA}.
HELIX 383 393 {ECO:0000244|PDB:2EPA}.
STRAND 394 396 {ECO:0000244|PDB:2EPA}.
STRAND 398 400 {ECO:0000244|PDB:2EPA}.
STRAND 409 412 {ECO:0000244|PDB:2EPA}.
HELIX 413 419 {ECO:0000244|PDB:2EPA}.
TURN 420 422 {ECO:0000244|PDB:2EPA}.
SEQUENCE 480 AA; 52555 MW; 78B1EBB0DB97579D CRC64;
MLNFGASLQQ TAEERMEMIS ERPKESMYSW NKTAEKSDFE AVEALMSMSC SWKSDFKKYV
ENRPVTPVSD LSEEENLLPG TPDFHTIPAF CLTPPYSPSD FEPSQVSNLM APAPSTVHFK
SLSDTAKPHI AAPFKEEEKS PVSAPKLPKA QATSVIRHTA DAQLCNHQTC PMKAASILNY
QNNSFRRRTH LNVEAARKNI PCAAVSPNRS KCERNTVADV DEKASAALYD FSVPSSETVI
CRSQPAPVSP QQKSVLVSPP AVSAGGVPPM PVICQMVPLP ANNPVVTTVV PSTPPSQPPA
VCPPVVFMGT QVPKGAVMFV VPQPVVQSSK PPVVSPNGTR LSPIAPAPGF SPSAAKVTPQ
IDSSRIRSHI CSHPGCGKTY FKSSHLKAHT RTHTGEKPFS CSWKGCERRF ARSDELSRHR
RTHTGEKKFA CPMCDRRFMR SDHLTKHARR HLSAKKLPNW QMEVSKLNDI ALPPTPAPTQ


Related products :

Catalog number Product name Quantity
E0688h ELISA EGR-alpha,Homo sapiens,Human,KLF10,Krueppel-like factor 10,TGFB-inducible early growth response protein 1,TIEG,TIEG1,TIEG-1,Transforming growth factor-beta-inducible early growth response protei 96T
E0688h ELISA kit EGR-alpha,Homo sapiens,Human,KLF10,Krueppel-like factor 10,TGFB-inducible early growth response protein 1,TIEG,TIEG1,TIEG-1,Transforming growth factor-beta-inducible early growth response p 96T
U0688h CLIA EGR-alpha,Homo sapiens,Human,KLF10,Krueppel-like factor 10,TGFB-inducible early growth response protein 1,TIEG,TIEG1,TIEG-1,Transforming growth factor-beta-inducible early growth response protein 96T
E0688r ELISA kit Cpg20,Klf10,Krueppel-like factor 10,Rat,Rattus norvegicus,TGFB-inducible early growth response protein 1,Tieg,Tieg1,TIEG-1,Transforming growth factor-beta-inducible early growth response pr 96T
E0688r ELISA Cpg20,Klf10,Krueppel-like factor 10,Rat,Rattus norvegicus,TGFB-inducible early growth response protein 1,Tieg,Tieg1,TIEG-1,Transforming growth factor-beta-inducible early growth response protein 96T
U0688r CLIA Cpg20,Klf10,Krueppel-like factor 10,Rat,Rattus norvegicus,TGFB-inducible early growth response protein 1,Tieg,Tieg1,TIEG-1,Transforming growth factor-beta-inducible early growth response protein 96T
18-003-43783 Krueppel-like factor 11 - Transforming growth factor-beta-inducible early growth response protein 2; TGFB-inducible early growth response protein 2; TIEG-2 Polyclonal 0.1 mg Protein A
U0688m CLIA Gdnfif,GDNF-inducible factor,Klf10,Krueppel-like factor 10,mGIF,Mouse,Mus musculus,TGFB-inducible early growth response protein 1,Tieg,Tieg1,TIEG-1,Transcription factor GIF,Transforming growth fa 96T
E0688m ELISA Gdnfif,GDNF-inducible factor,Klf10,Krueppel-like factor 10,mGIF,Mouse,Mus musculus,TGFB-inducible early growth response protein 1,Tieg,Tieg1,TIEG-1,Transcription factor GIF,Transforming growth f 96T
E0688m ELISA kit Gdnfif,GDNF-inducible factor,Klf10,Krueppel-like factor 10,mGIF,Mouse,Mus musculus,TGFB-inducible early growth response protein 1,Tieg,Tieg1,TIEG-1,Transcription factor GIF,Transforming gro 96T
20-372-60104 Kruppel-like factor 11. mRNA (cDNA clone MGC 104116IMAGE 30915570). - Mouse monoclonal anti-human KLF11 antibody; Transforming growth factor-beta-inducible early growth response protein 2; TGFB-induci 0.1 mg
gen9998 KLF10_MOUSE Transforming growth factor-beta-inducible early growth response protein 1 ELISA tesk kit 1
gen10006 KLF10_RAT Transforming growth factor-beta-inducible early growth response protein 1 ELISA tesk kit 1
gen9987 KLF10_HUMAN Transforming growth factor-beta-inducible early growth response protein 1 ELISA tesk kit 1
EIAAB43330 FGF-inducible 14,Fgfrp2,Fibroblast growth factor-inducible immediate-early response protein 14,Fibroblast growth factor-regulated protein 2,Fn14,Mouse,Mus musculus,Tnfrsf12a,Tumor necrosis factor rece
gen9983 KLF10_HUMAN TGFB-inducible early growth response protein 1 ELISA tesk kit 1
gen9993 KLF10_MOUSE TGFB-inducible early growth response protein 1 ELISA tesk kit 1
gen10002 KLF10_RAT TGFB-inducible early growth response protein 1 ELISA tesk kit 1
EIAAB12630 Early growth response protein 4,Early response protein NGFI-C,Egr4,EGR-4,Egr-4,Nerve growth factor-induced protein C,Ngfic,NGFI-C,Rat,Rattus norvegicus
EIAAB43331 FGF-inducible 14,Fibroblast growth factor-inducible immediate-early response protein 14,FN14,Homo sapiens,Human,TNFRSF12A,Tumor necrosis factor receptor superfamily member 12A,TweakR,Tweak-receptor
ABP-PAB-10136 TGFB inducible early growth response 2 (TIEG2) polyclonal antibody 100 ug
18-272-195936 TNFRSF12A - Rabbit polyclonal to TNFRSF12A; Fibroblast growth factor-inducible immediate-early response protein 14; FGF-inducible 14; Tweak-receptor; TweakR; CD266 antigen Polyclonal 0.2 ml
E0416r ELISA Early growth response protein 1,Egr1,EGR-1,Nerve growth factor-induced protein A,NGFI-A,Rat,Rattus norvegicus,Transcription factor Zif268,Zinc finger protein Krox-24 96T
E0416r ELISA kit Early growth response protein 1,Egr1,EGR-1,Nerve growth factor-induced protein A,NGFI-A,Rat,Rattus norvegicus,Transcription factor Zif268,Zinc finger protein Krox-24 96T
U0416r CLIA Early growth response protein 1,Egr1,EGR-1,Nerve growth factor-induced protein A,NGFI-A,Rat,Rattus norvegicus,Transcription factor Zif268,Zinc finger protein Krox-24 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur