Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Krueppel-like factor 6 (B-cell-derived protein 1) (Core promoter element-binding protein) (GC-rich sites-binding factor GBF) (Proto-oncogene BCD1) (Suppressor of tumorigenicity 12 protein) (Transcription factor Zf9)

 KLF6_HUMAN              Reviewed;         283 AA.
Q99612; B2RE86; B4DDN0; D3DRR1; F5H3M5; Q5VUT7; Q5VUT8; Q9BT79;
30-MAY-2000, integrated into UniProtKB/Swiss-Prot.
30-MAY-2000, sequence version 3.
10-OCT-2018, entry version 181.
RecName: Full=Krueppel-like factor 6;
AltName: Full=B-cell-derived protein 1;
AltName: Full=Core promoter element-binding protein;
AltName: Full=GC-rich sites-binding factor GBF;
AltName: Full=Proto-oncogene BCD1;
AltName: Full=Suppressor of tumorigenicity 12 protein;
AltName: Full=Transcription factor Zf9;
Name=KLF6; Synonyms=BCD1, COPEB, CPBP, ST12;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
PRELIMINARY NUCLEOTIDE SEQUENCE (ISOFORM 1).
PubMed=9000136;
El Rouby S., Newcomb E.W.;
"Identification of Bcd, a novel proto-oncogene expressed in B-cells.";
Oncogene 13:2623-2630(1996).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Placenta;
PubMed=9083102; DOI=10.1074/jbc.272.14.9573;
Koritschoner N.P., Bocco J.L., Panzetta-Dutari G.M., Dumur C.I.,
Flury A., Patrito L.C.;
"A novel human zinc finger protein that interacts with the core
promoter element of a TATA box-less gene.";
J. Biol. Chem. 272:9573-9580(1997).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Hepatic stellate cell;
PubMed=9689109; DOI=10.1073/pnas.95.16.9500;
Ratziu V., Lalazar A., Wong L., Dang Q., Collins C., Shaulian E.,
Jensen S., Friedman S.L.;
"Zf9, a Kruppel-like transcription factor up-regulated in vivo during
early hepatic fibrosis.";
Proc. Natl. Acad. Sci. U.S.A. 95:9500-9505(1998).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND CHARACTERIZATION.
TISSUE=Leukocyte;
PubMed=9685731; DOI=10.1093/oxfordjournals.jbchem.a022124;
Suzuki T., Yamamoto T., Kurabayashi M., Nagai R., Yazaki Y.,
Horikoshi M.;
"Isolation and initial characterization of GBF, a novel DNA-binding
zinc finger protein that binds to the GC-rich binding sites of the
HIV-1 promoter.";
J. Biochem. 124:389-395(1998).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Koritschoner N.P.;
"Genomic organization of the human COPEB/CPBP locus.";
Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
Phelan M., Farmer A.;
"Cloning of human full-length CDSs in BD Creator(TM) system donor
vector.";
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
TISSUE=Brain;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15164054; DOI=10.1038/nature02462;
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L.,
Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K.,
Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L.,
Taylor A., Battles J., Bird C.P., Ainscough R., Almeida J.P.,
Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J.,
Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J.,
Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D.,
Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S.,
Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L.,
Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S.,
Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L.,
Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J.,
Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M.,
Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S.,
Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M.,
Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A.,
Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T.,
Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I.,
Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T.,
Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M.,
Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W.,
Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H.,
Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L.,
Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K.,
Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T.,
Doucette-Stamm L., Beck S., Smith D.R., Rogers J.;
"The DNA sequence and comparative analysis of human chromosome 10.";
Nature 429:375-381(2004).
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Lung;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[11]
INVOLVEMENT IN PC, VARIANTS ARG-64; PRO-116; ASP-123 AND PRO-169, AND
CHARACTERIZATION OF VARIANTS ARG-64; PRO-116; ASP-123 AND PRO-169.
PubMed=11752579; DOI=10.1126/science.1066326;
Narla G., Heath K.E., Reeves H.L., Li D., Giono L.E., Kimmelman A.C.,
Glucksman M.J., Narla J., Eng F.J., Chan A.M., Ferrari A.C.,
Martignetti J.A., Friedman S.L.;
"KLF6, a candidate tumor suppressor gene mutated in prostate cancer.";
Science 294:2563-2566(2001).
[12]
INVOLVEMENT IN GASC, AND VARIANTS ARG-155; THR-172; LEU-180 AND
LYS-198.
PubMed=15824733; DOI=10.1038/sj.onc.1208670;
Cho Y.G., Kim C.J., Park C.H., Yang Y.M., Kim S.Y., Nam S.W.,
Lee S.H., Yoo N.J., Lee J.Y., Park W.S.;
"Genetic alterations of the KLF6 gene in gastric cancer.";
Oncogene 24:4588-4590(2005).
-!- FUNCTION: Transcriptional activator (By similarity). Binds a GC
box motif. Could play a role in B-cell growth and development.
{ECO:0000250}.
-!- INTERACTION:
Q04206:RELA; NbExp=6; IntAct=EBI-714994, EBI-73886;
-!- SUBCELLULAR LOCATION: Nucleus.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q99612-1; Sequence=Displayed;
Name=2;
IsoId=Q99612-2; Sequence=VSP_015715;
Note=No experimental confirmation available.;
Name=3;
IsoId=Q99612-3; Sequence=VSP_045808;
-!- TISSUE SPECIFICITY: Highly expressed in placenta followed by
spleen, thymus, prostate, testis, small intestine and colon.
Weakly expressed in pancreas, lung, liver, heart and skeletal
muscle. Also expressed in fetal brain, spleen and thymus.
-!- DOMAIN: The acidic N-terminal part may favor interaction with the
basic domain of transcription factors.
-!- DISEASE: Gastric cancer (GASC) [MIM:613659]: A malignant disease
which starts in the stomach, can spread to the esophagus or the
small intestine, and can extend through the stomach wall to nearby
lymph nodes and organs. It also can metastasize to other parts of
the body. The term gastric cancer or gastric carcinoma refers to
adenocarcinoma of the stomach that accounts for most of all
gastric malignant tumors. Two main histologic types are
recognized, diffuse type and intestinal type carcinomas. Diffuse
tumors are poorly differentiated infiltrating lesions, resulting
in thickening of the stomach. In contrast, intestinal tumors are
usually exophytic, often ulcerating, and associated with
intestinal metaplasia of the stomach, most often observed in
sporadic disease. {ECO:0000269|PubMed:15824733}. Note=The disease
is caused by mutations affecting the gene represented in this
entry.
-!- DISEASE: Prostate cancer (PC) [MIM:176807]: A malignancy
originating in tissues of the prostate. Most prostate cancers are
adenocarcinomas that develop in the acini of the prostatic ducts.
Other rare histopathologic types of prostate cancer that occur in
approximately 5% of patients include small cell carcinoma,
mucinous carcinoma, prostatic ductal carcinoma, transitional cell
carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid
cystic carcinoma (basaloid), signet-ring cell carcinoma and
neuroendocrine carcinoma. {ECO:0000269|PubMed:11752579}. Note=The
disease is caused by mutations affecting the gene represented in
this entry.
-!- SIMILARITY: Belongs to the krueppel C2H2-type zinc-finger protein
family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAC23699.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Sequence=BAA33050.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology
and Haematology;
URL="http://atlasgeneticsoncology.org/Genes/KLF6ID44002ch10p15.html";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; U44975; AAC23699.1; ALT_INIT; mRNA.
EMBL; AF001461; AAC39929.1; -; mRNA.
EMBL; AB017493; BAA33050.1; ALT_INIT; mRNA.
EMBL; AF284036; AAM73548.1; -; Genomic_DNA.
EMBL; BT006778; AAP35424.1; -; mRNA.
EMBL; AL513303; CAH74049.1; -; Genomic_DNA.
EMBL; AL450322; CAH74049.1; JOINED; Genomic_DNA.
EMBL; AK293259; BAG56791.1; -; mRNA.
EMBL; AK316596; BAG38183.1; -; mRNA.
EMBL; AL513303; CAH74050.1; -; Genomic_DNA.
EMBL; AL450322; CAH74050.1; JOINED; Genomic_DNA.
EMBL; AL450322; CAH71010.1; -; Genomic_DNA.
EMBL; AL513303; CAH71010.1; JOINED; Genomic_DNA.
EMBL; AL450322; CAH71011.1; -; Genomic_DNA.
EMBL; AL513303; CAH71011.1; JOINED; Genomic_DNA.
EMBL; CH471072; EAW86477.1; -; Genomic_DNA.
EMBL; CH471072; EAW86479.1; -; Genomic_DNA.
EMBL; BC000311; AAH00311.1; -; mRNA.
CCDS; CCDS53490.1; -. [Q99612-3]
CCDS; CCDS7060.1; -. [Q99612-1]
PIR; JE0235; JE0235.
RefSeq; NP_001153596.1; NM_001160124.1.
RefSeq; NP_001153597.1; NM_001160125.1. [Q99612-3]
RefSeq; NP_001291.3; NM_001300.5. [Q99612-1]
UniGene; Hs.4055; -.
UniGene; Hs.709396; -.
ProteinModelPortal; Q99612; -.
SMR; Q99612; -.
BioGrid; 107711; 18.
IntAct; Q99612; 9.
STRING; 9606.ENSP00000419923; -.
iPTMnet; Q99612; -.
PhosphoSitePlus; Q99612; -.
BioMuta; KLF6; -.
DMDM; 7387592; -.
EPD; Q99612; -.
MaxQB; Q99612; -.
PaxDb; Q99612; -.
PeptideAtlas; Q99612; -.
PRIDE; Q99612; -.
ProteomicsDB; 78355; -.
ProteomicsDB; 78356; -. [Q99612-2]
DNASU; 1316; -.
Ensembl; ENST00000469435; ENSP00000419079; ENSG00000067082. [Q99612-2]
Ensembl; ENST00000497571; ENSP00000419923; ENSG00000067082. [Q99612-1]
Ensembl; ENST00000542957; ENSP00000445301; ENSG00000067082. [Q99612-3]
GeneID; 1316; -.
KEGG; hsa:1316; -.
UCSC; uc001iha.4; human. [Q99612-1]
CTD; 1316; -.
DisGeNET; 1316; -.
EuPathDB; HostDB:ENSG00000067082.14; -.
GeneCards; KLF6; -.
HGNC; HGNC:2235; KLF6.
HPA; CAB013529; -.
HPA; HPA069585; -.
MalaCards; KLF6; -.
MIM; 176807; phenotype.
MIM; 602053; gene.
MIM; 613659; phenotype.
neXtProt; NX_Q99612; -.
OpenTargets; ENSG00000067082; -.
PharmGKB; PA26751; -.
eggNOG; KOG1721; Eukaryota.
eggNOG; COG5048; LUCA.
GeneTree; ENSGT00760000118998; -.
HOGENOM; HOG000231192; -.
HOVERGEN; HBG000836; -.
InParanoid; Q99612; -.
KO; K09207; -.
OMA; PSHLWGC; -.
OrthoDB; EOG091G1BN0; -.
PhylomeDB; Q99612; -.
TreeFam; TF350556; -.
SignaLink; Q99612; -.
SIGNOR; Q99612; -.
ChiTaRS; KLF6; human.
GeneWiki; KLF6; -.
GenomeRNAi; 1316; -.
PRO; PR:Q99612; -.
Proteomes; UP000005640; Chromosome 10.
Bgee; ENSG00000067082; Expressed in 238 organ(s), highest expression level in thyroid gland.
CleanEx; HS_KLF6; -.
Genevisible; Q99612; HS.
GO; GO:0005829; C:cytosol; IDA:HPA.
GO; GO:0001650; C:fibrillar center; IDA:HPA.
GO; GO:0043231; C:intracellular membrane-bounded organelle; IDA:HPA.
GO; GO:0005730; C:nucleolus; IDA:HPA.
GO; GO:0005634; C:nucleus; IDA:HPA.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0000978; F:RNA polymerase II proximal promoter sequence-specific DNA binding; IDA:NTNU_SB.
GO; GO:0000981; F:RNA polymerase II transcription factor activity, sequence-specific DNA binding; ISA:NTNU_SB.
GO; GO:0001077; F:transcriptional activator activity, RNA polymerase II proximal promoter sequence-specific DNA binding; IDA:NTNU_SB.
GO; GO:0030183; P:B cell differentiation; NAS:UniProtKB.
GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; IDA:NTNU_SB.
GO; GO:0045893; P:positive regulation of transcription, DNA-templated; TAS:UniProtKB.
InterPro; IPR036236; Znf_C2H2_sf.
InterPro; IPR013087; Znf_C2H2_type.
Pfam; PF00096; zf-C2H2; 3.
SMART; SM00355; ZnF_C2H2; 3.
SUPFAM; SSF57667; SSF57667; 2.
PROSITE; PS00028; ZINC_FINGER_C2H2_1; 3.
PROSITE; PS50157; ZINC_FINGER_C2H2_2; 3.
1: Evidence at protein level;
Activator; Alternative splicing; Complete proteome; DNA-binding;
Metal-binding; Nucleus; Polymorphism; Reference proteome; Repeat;
Transcription; Transcription regulation; Zinc; Zinc-finger.
CHAIN 1 283 Krueppel-like factor 6.
/FTId=PRO_0000047171.
ZN_FING 200 224 C2H2-type 1. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
ZN_FING 230 254 C2H2-type 2. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
ZN_FING 260 282 C2H2-type 3. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
VAR_SEQ 227 283 EKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDR
CFSRSDHLALHMKRHL -> QCPRGPRRAAAGGRHCIAPAL
EGAGPGCTGCGQGRQILTSSDVFHQSIRSFWSSE (in
isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_015715.
VAR_SEQ 227 283 EKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDR
CFSRSDHLALHMKRHL -> VFPGLTTWPCT (in
isoform 3). {ECO:0000305}.
/FTId=VSP_045808.
VARIANT 64 64 W -> R (found in prostate cancer samples;
somatic mutation; does not up-regulates
CDKN1A in a p53-independent manner and
significantly reduces cell proliferation;
dbSNP:rs121909142).
{ECO:0000269|PubMed:11752579}.
/FTId=VAR_065136.
VARIANT 116 116 S -> P (found in prostate cancer samples;
somatic mutation; does not up-regulates
CDKN1A in a p53-independent manner and
significantly reduces cell proliferation;
dbSNP:rs121909139).
{ECO:0000269|PubMed:11752579}.
/FTId=VAR_065137.
VARIANT 123 123 A -> D (found in prostate cancer samples;
somatic mutation; does not up-regulates
CDKN1A in a p53-independent manner and
significantly reduces cell proliferation;
dbSNP:rs121909141).
{ECO:0000269|PubMed:11752579}.
/FTId=VAR_065138.
VARIANT 155 155 S -> R (found in gastric cancer samples;
somatic mutation; dbSNP:rs121909144).
{ECO:0000269|PubMed:15824733}.
/FTId=VAR_065139.
VARIANT 169 169 L -> P (found in prostate cancer samples;
somatic mutation; does not up-regulates
CDKN1A in a p53-independent manner and
significantly reduces cell proliferation;
dbSNP:rs121909143).
{ECO:0000269|PubMed:11752579}.
/FTId=VAR_065140.
VARIANT 172 172 P -> T (found in gastric cancer samples;
somatic mutation).
{ECO:0000269|PubMed:15824733}.
/FTId=VAR_065141.
VARIANT 180 180 S -> L (found in gastric cancer samples;
somatic mutation; dbSNP:rs372338890).
{ECO:0000269|PubMed:15824733}.
/FTId=VAR_065142.
VARIANT 198 198 R -> K (found in gastric cancer samples;
somatic mutation).
{ECO:0000269|PubMed:15824733}.
/FTId=VAR_065143.
CONFLICT 276 276 A -> G (in Ref. 3; AAC39929).
{ECO:0000305}.
SEQUENCE 283 AA; 31865 MW; 84294A7E6D0A0231 CRC64;
MDVLPMCSIF QELQIVHETG YFSALPSLEE YWQQTCLELE RYLQSEPCYV SASEIKFDSQ
EDLWTKIILA REKKEESELK ISSSPPEDTL ISPSFCYNLE TNSLNSDVSS ESSDSSEELS
PTAKFTSDPI GEVLVSSGKL SSSVTSTPPS SPELSREPSQ LWGCVPGELP SPGKVRSGTS
GKPGDKGNGD ASPDGRRRVH RCHFNGCRKV YTKSSHLKAH QRTHTGEKPY RCSWEGCEWR
FARSDELTRH FRKHTGAKPF KCSHCDRCFS RSDHLALHMK RHL


Related products :

Catalog number Product name Quantity
18-003-43322 Krueppel-like factor 6 - Core promoter element-binding protein; B-cell-derived protein 1; Proto-oncogene BCD1; Transcription factor Zf9; GC-rich sites-binding factor GBF Polyclonal 0.05 mg Aff Pur
18-001-30002 Krueppel-like factor 13 - Transcription factor BTEB3; Basic transcription element-binding protein 3; BTE-binding protein 3; RANTES factor of late activated T-lymphocytes 1; RFLAT-1; Transcription fact 0.1 mg
18-003-42035 Krueppel-like factor 9 - Transcription factor BTEB1; Basic transcription element-binding protein 1; BTE-binding protein 1; GC box-binding protein 1 Polyclonal 0.05 mg Aff Pur
18-003-42521 Nuclease sensitive element-binding protein 1 - Y-box-binding protein 1; Y-box transcription factor; YB-1; CCAAT-binding transcription factor I subunit A; CBF-A; Enhancer factor I subunit A; EFI-A; DNA 0.05 mg Aff Pur
18-003-43926 Runt-related transcription factor 2 - Core-binding factor. alpha 1 subunit; CBF-alpha 1; Acute myeloid leukemia 3 protein; Oncogene AML-3; Polyomavirus enhancer-binding protein 2 alpha A subunit; PEBP 0.1 mg Protein A
18-003-44065 Runt-related transcription factor 1 - Core-binding factor. alpha 2 subunit; CBF-alpha 2; Acute myeloid leukemia 1 protein; Oncogene AML-1; Polyomavirus enhancer-binding protein 2 alpha B subunit; PEBP 0.05 mg Aff Pur
EIAAB46626 CBF-A,CCAAT-binding transcription factor I subunit A,DBPB,DNA-binding protein B,EFI-A,Enhancer factor I subunit A,Homo sapiens,Human,NSEP1,Nuclease-sensitive element-binding protein 1,YB1,YB-1,Y-box t
EIAAB46625 CBF-A,CCAAT-binding transcription factor I subunit A,DBPB,DNA-binding protein B,EFI-A,Enhancer factor I subunit A,Mouse,Msy1,Msy-1,Mus musculus,Nsep1,Nuclease-sensitive element-binding protein 1,Yb1,Y
EIAAB46624 CBF-A,CCAAT-binding transcription factor I subunit A,DBPB,DNA-binding protein B,EFI-A,Enhancer factor I subunit A,Msy-1,Nsep1,Nuclease-sensitive element-binding protein 1,Rat,Rattus norvegicus,Yb1,YB-
EIAAB46627 Bos taurus,Bovine,CBF-A,CCAAT-binding transcription factor I subunit A,DBPB,DNA-binding protein B,EFI-A,Enhancer factor I subunit A,NSEP1,Nuclease-sensitive element-binding protein 1,YB1,YB-1,Y-box tr
EIAAB47268 Beta enolase repressor factor 1,G-rich box-binding protein,Mouse,Mus musculus,Transcription factor BFCOL1,Transcription factor ZBP-89,Zbp89,Zfp148,Zinc finger DNA-binding protein 89,Zinc finger protei
EIAAB41697 Homo sapiens,Human,KIAA0292,Nuclear factor SPBP,Protein AR1,SPBP,SPRE-binding protein,Stromelysin-1 PDGF-responsive element-binding protein,TCF20,TCF-20,Transcription factor 20
EIAAB25653 Homo sapiens,hPCl2,Human,Metal regulatory transcription factor 2,Metal-response element DNA-binding protein M96,Metal-response element-binding transcription factor 2,MTF2,PCL2,Polycomb-like protein 2
18-003-44064 Cyclic AMP-dependent transcription factor ATF-4 - Activating transcription factor 4; DNA-binding protein TAXREB67; Cyclic AMP response element-binding protein 2; CREB2 Polyclonal 0.1 mg Protein A
EIAAB25652 Metal regulatory transcription factor 2,Metal-response element DNA-binding protein M96,Metal-response element-binding transcription factor 2,Mouse,mPCl2,Mtf2,Mus musculus,Pcl2,Polycomb-like protein 2,
EIAAB06706 C_EBP gamma,CCAAT_enhancer-binding protein gamma,Cebpg,GPE1-binding protein,GPE1-BP,Granulocyte colony-stimulating factor promoter element 1-binding protein,IG_EBP-1,Immunoglobulin enhancer-binding pr
EIAAB09243 cAMP-responsive element-binding protein 3-like protein 3,CREB3L3,CREBH,Cyclic AMP-responsive element-binding protein 3-like protein 3,Homo sapiens,Human,HYST1481,Transcription factor CREB-H
EIAAB27823 Alpha-1-fetoprotein transcription factor,B1-binding factor,B1F,CPF,CYP7A promoter-binding factor,FTF,hB1F,Hepatocytic transcription factor,Homo sapiens,Human,Liver receptor homolog 1,LRH-1,NR5A2,Nucle
EIAAB09244 cAMP-responsive element-binding protein 3-like protein 3,Creb3l3,Crebh,Cyclic AMP-responsive element-binding protein 3-like protein 3,Mouse,Mus musculus,Transcription factor CREB-H
EIAAB41698 Mouse,Mus musculus,Nuclear factor SPBP,Spbp,SPRE-binding protein,Stromelysin-1 PDGF-responsive element-binding protein,Tcf20,TCF-20,Transcription factor 20
EIAAB09242 cAMP-responsive element-binding protein 3-like protein 3,Creb3l3,Cyclic AMP-responsive element-binding protein 3-like protein 3,Rat,Rattus norvegicus,Transcription factor CREB-H
18-003-44195 Heterogeneous nuclear ribonucleoprotein D-like - hnRPD-like protein; hnHNRP-DL; JKT41-binding protein; AU-rich element RNA-binding factor; Protein laAUF1 Polyclonal 0.1 mg Protein A
EIAAB46629 CBF-A,CCAAT-binding transcription factor I subunit A,EFI-A,Enhancer factor I subunit A,NSEP1,Nuclease-sensitive element-binding protein 1,Oryctolagus cuniculus,p50,Rabbit,YB1,YB-1,Y-box transcription
EIAAB27068 E4 promoter-binding protein 4,E4bp4,Embryo implantation-related NFIL3_E4BP4-like transcription factor,Mouse,Mus musculus,Nfil3,Nuclear factor interleukin-3-regulated protein
28-891 XBP1 is a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. XBP1 is a bZIP protein, which was also identified as a cellular transcription 0.05 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur