Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Krueppel-like factor 7 (Ubiquitous krueppel-like factor)

 KLF7_HUMAN              Reviewed;         302 AA.
O75840; B2RB03; B7Z4F7; C9JF04; E7EWH1; L0R4P2; Q7Z3H8; Q96E51;
15-JUL-1999, integrated into UniProtKB/Swiss-Prot.
01-NOV-1998, sequence version 1.
10-MAY-2017, entry version 139.
RecName: Full=Krueppel-like factor 7;
AltName: Full=Ubiquitous krueppel-like factor;
Name=KLF7; Synonyms=UKLF;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=9774444; DOI=10.1074/jbc.273.43.28229;
Matsumoto N., Laub F., Aldabe R., Zhang W., Ramirez F., Yoshida T.,
Terada M.;
"Cloning the cDNA for a new human zinc finger protein defines a group
of closely related Krueppel-like transcription factors.";
J. Biol. Chem. 273:28229-28237(1998).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5 AND 6), AND ALTERNATIVE
SPLICING.
PubMed=23134681; DOI=10.1096/fj.12-220319;
Camacho-Vanegas O., Till J., Miranda-Lorenzo I., Ozturk B.,
Camacho S.C., Martignetti J.A.;
"Shaking the family tree: Identification of novel and biologically
active alternatively spliced isoforms across the KLF family of
transcription factors.";
FASEB J. 27:432-436(2013).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Heart;
PubMed=11230166; DOI=10.1101/gr.GR1547R;
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S.,
Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H.,
Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N.,
Mewes H.-W., Ottenwaelder B., Obermaier B., Tampe J., Heubner D.,
Wambutt R., Korn B., Klein M., Poustka A.;
"Towards a catalog of human genes and proteins: sequencing and
analysis of 500 novel complete protein coding human cDNAs.";
Genome Res. 11:422-435(2001).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
Korn B., Zuo D., Hu Y., LaBaer J.;
"Cloning of human full open reading frames in Gateway(TM) system entry
vector (pDONR201).";
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
TISSUE=Placenta;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
TISSUE=Testis;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
-!- FUNCTION: Transcriptional activator. Binds in vitro to the CACCC
motif of the beta-globin promoter and to the SP1 recognition
sequence.
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=6;
Name=1;
IsoId=O75840-1; Sequence=Displayed;
Name=2;
IsoId=O75840-2; Sequence=VSP_047030;
Name=3;
IsoId=O75840-3; Sequence=VSP_047032;
Name=4;
IsoId=O75840-4; Sequence=VSP_047031;
Name=5;
IsoId=O75840-5; Sequence=VSP_047478;
Name=6;
IsoId=O75840-6; Sequence=VSP_047477, VSP_047479;
-!- TISSUE SPECIFICITY: Ubiquitous and highly expressed in brain and
spinal cord in the adult, and in kidney and brain in the embryo.
-!- DOMAIN: The acidic N-terminal part may favor interaction with the
basic domain of transcription factors.
-!- SIMILARITY: Belongs to the krueppel C2H2-type zinc-finger protein
family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AB015132; BAA33521.1; -; mRNA.
EMBL; HF546205; CCO02791.1; -; mRNA.
EMBL; HF546206; CCO02792.1; -; mRNA.
EMBL; BX537890; CAD97885.1; -; mRNA.
EMBL; CR542112; CAG46909.1; -; mRNA.
EMBL; AK297312; BAH12543.1; -; mRNA.
EMBL; AK314439; BAG37050.1; -; mRNA.
EMBL; AC007879; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC008062; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471063; EAW70400.1; -; Genomic_DNA.
EMBL; CH471063; EAW70402.1; -; Genomic_DNA.
EMBL; CH471063; EAW70403.1; -; Genomic_DNA.
EMBL; BC012919; AAH12919.1; -; mRNA.
CCDS; CCDS2373.1; -. [O75840-1]
CCDS; CCDS59438.1; -. [O75840-4]
CCDS; CCDS59439.1; -. [O75840-3]
CCDS; CCDS59440.1; -. [O75840-2]
RefSeq; NP_001257871.1; NM_001270942.1. [O75840-3]
RefSeq; NP_001257872.1; NM_001270943.1. [O75840-2]
RefSeq; NP_001257873.1; NM_001270944.1. [O75840-4]
RefSeq; NP_003700.1; NM_003709.3. [O75840-1]
RefSeq; XP_016860650.1; XM_017005161.1. [O75840-1]
RefSeq; XP_016860653.1; XM_017005164.1. [O75840-3]
UniGene; Hs.471221; -.
UniGene; Hs.59908; -.
ProteinModelPortal; O75840; -.
SMR; O75840; -.
BioGrid; 114168; 2.
STRING; 9606.ENSP00000309570; -.
iPTMnet; O75840; -.
PhosphoSitePlus; O75840; -.
MaxQB; O75840; -.
PaxDb; O75840; -.
PeptideAtlas; O75840; -.
PRIDE; O75840; -.
DNASU; 8609; -.
Ensembl; ENST00000309446; ENSP00000309570; ENSG00000118263. [O75840-1]
Ensembl; ENST00000412414; ENSP00000403284; ENSG00000118263. [O75840-4]
Ensembl; ENST00000421199; ENSP00000387510; ENSG00000118263. [O75840-2]
Ensembl; ENST00000423015; ENSP00000398572; ENSG00000118263. [O75840-3]
Ensembl; ENST00000458272; ENSP00000393268; ENSG00000118263. [O75840-5]
GeneID; 8609; -.
KEGG; hsa:8609; -.
UCSC; uc002vbz.3; human. [O75840-1]
CTD; 8609; -.
DisGeNET; 8609; -.
GeneCards; KLF7; -.
HGNC; HGNC:6350; KLF7.
HPA; HPA030490; -.
MIM; 604865; gene.
neXtProt; NX_O75840; -.
OpenTargets; ENSG00000118263; -.
PharmGKB; PA30140; -.
eggNOG; KOG1721; Eukaryota.
eggNOG; COG5048; LUCA.
GeneTree; ENSGT00760000118998; -.
HOGENOM; HOG000231192; -.
HOVERGEN; HBG000836; -.
InParanoid; O75840; -.
KO; K09207; -.
OMA; DLDCFLR; -.
OrthoDB; EOG091G1BN0; -.
PhylomeDB; O75840; -.
TreeFam; TF350556; -.
SIGNOR; O75840; -.
ChiTaRS; KLF7; human.
GeneWiki; KLF7; -.
GenomeRNAi; 8609; -.
PRO; PR:O75840; -.
Proteomes; UP000005640; Chromosome 2.
Bgee; ENSG00000118263; -.
CleanEx; HS_KLF7; -.
ExpressionAtlas; O75840; baseline and differential.
Genevisible; O75840; HS.
GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell.
GO; GO:0000978; F:RNA polymerase II core promoter proximal region sequence-specific DNA binding; IDA:NTNU_SB.
GO; GO:0003713; F:transcription coactivator activity; TAS:ProtInc.
GO; GO:0003700; F:transcription factor activity, sequence-specific DNA binding; TAS:ProtInc.
GO; GO:0001077; F:transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding; IDA:NTNU_SB.
GO; GO:0008270; F:zinc ion binding; TAS:ProtInc.
GO; GO:0007411; P:axon guidance; IEA:Ensembl.
GO; GO:0048813; P:dendrite morphogenesis; IEA:Ensembl.
GO; GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; IDA:NTNU_SB.
GO; GO:0006357; P:regulation of transcription from RNA polymerase II promoter; TAS:ProtInc.
Gene3D; 3.30.40.10; -; 1.
InterPro; IPR013087; Znf_C2H2_type.
InterPro; IPR013083; Znf_RING/FYVE/PHD.
SMART; SM00355; ZnF_C2H2; 3.
SUPFAM; SSF57667; SSF57667; 2.
PROSITE; PS00028; ZINC_FINGER_C2H2_1; 3.
PROSITE; PS50157; ZINC_FINGER_C2H2_2; 3.
2: Evidence at transcript level;
Activator; Alternative splicing; Complete proteome; DNA-binding;
Metal-binding; Nucleus; Reference proteome; Repeat; Transcription;
Transcription regulation; Zinc; Zinc-finger.
CHAIN 1 302 Krueppel-like factor 7.
/FTId=PRO_0000047174.
ZN_FING 219 243 C2H2-type 1. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
ZN_FING 249 273 C2H2-type 2. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
ZN_FING 279 301 C2H2-type 3. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
MOTIF 215 220 Nuclear localization signal.
{ECO:0000255}.
VAR_SEQ 1 34 MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQ -> M
(in isoform 2).
{ECO:0000303|PubMed:11230166}.
/FTId=VSP_047030.
VAR_SEQ 1 34 MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQ -> MFP
SWP (in isoform 4).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_047031.
VAR_SEQ 35 87 TCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFR
RLDPLLLPVEAA -> VRSLISAHGRDVSGVLHEAMSSRGT
TGNTQVQSPSNATTATGVFPGLTILPST (in isoform
6). {ECO:0000303|PubMed:23134681}.
/FTId=VSP_047477.
VAR_SEQ 55 244 Missing (in isoform 5).
{ECO:0000303|PubMed:23134681}.
/FTId=VSP_047478.
VAR_SEQ 88 302 Missing (in isoform 6).
{ECO:0000303|PubMed:23134681}.
/FTId=VSP_047479.
VAR_SEQ 179 302 GGVATAAAAVTAAGAVKSGQSDSDQGGLGAEACPENKKRVH
RCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRF
ARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKRH
I -> RSLISAHGRDVSGVLHEAMSSRGTTGNTQVQSPSNA
TTATGVFPGLTILPST (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_047032.
SEQUENCE 302 AA; 33362 MW; 95141CE3A42C5774 CRC64;
MDVLASYSIF QELQLVHDTG YFSALPSLEE TWQQTCLELE RYLQTEPRRI SETFGEDLDC
FLHASPPPCI EESFRRLDPL LLPVEAAICE KSSAVDILLS RDKLLSETCL SLQPASSSLD
SYTAVNQAQL NAVTSLTPPS SPELSRHLVK TSQTLSAVDG TVTLKLVAKK AALSSVKVGG
VATAAAAVTA AGAVKSGQSD SDQGGLGAEA CPENKKRVHR CQFNGCRKVY TKSSHLKAHQ
RTHTGEKPYK CSWEGCEWRF ARSDELTRHY RKHTGAKPFK CNHCDRCFSR SDHLALHMKR
HI


Related products :

Catalog number Product name Quantity
18-003-42060 Krueppel-like factor 8 - Basic krueppel-like factor 3; Zinc finger protein 741 Polyclonal 0.05 mg Aff Pur
18-003-42303 Krueppel-like factor 8 - Basic krueppel-like factor 3; Zinc finger protein 741 Polyclonal 0.05 mg Aff Pur
18-003-42248 Krueppel-like factor 15 - Kidney-enriched krueppel-like factor Polyclonal 0.1 mg Protein A
18-003-42295 Krueppel-like factor 1 - Erythroid krueppel-like transcription factor; EKLF; Erythroid transcription factor Polyclonal 0.1 mg Protein A
EIAAB39332 Homo sapiens,Human,KLF14,Krueppel-like factor 14,SP6,Transcription factor Sp6
EIAAB39333 Epfn,Epiprofin,Klf14,Krueppel-like factor 14,Mouse,Mus musculus,Sp6,Transcription factor Sp6
18-003-43322 Krueppel-like factor 6 - Core promoter element-binding protein; B-cell-derived protein 1; Proto-oncogene BCD1; Transcription factor Zf9; GC-rich sites-binding factor GBF Polyclonal 0.05 mg Aff Pur
E0245m Rat ELISA Kit FOR Krueppel-like factor 6 96T
CK021_HUMAN Rat ELISA Kit FOR Krueppel-like factor 6 96T
MORN1_HUMAN Rat ELISA Kit FOR Krueppel-like factor 6 96T
KLF2_RAT Rat ELISA Kit FOR Krueppel-like factor 2 96T
EH1008 Krueppel-like factor 10 Elisa Kit 96T
EH789 Krueppel-like factor 14 Elisa Kit 96T
EH787 Krueppel-like factor 13 Elisa Kit 96T
E0688m ELISA kit Gdnfif,GDNF-inducible factor,Klf10,Krueppel-like factor 10,mGIF,Mouse,Mus musculus,TGFB-inducible early growth response protein 1,Tieg,Tieg1,TIEG-1,Transcription factor GIF,Transforming gro 96T
ant-434 Mouse Anti Human Krueppel-like factor 4 100
KLF1_MOUSE Mouse ELISA Kit FOR Krueppel-like factor 1 96T
CH54 Recombinant Human Krueppel-like factor 6 1 mg
E15006h Mouse ELISA Kit FOR Krueppel-like factor 3 96T
KLF8_MOUSE Mouse ELISA Kit FOR Krueppel-like factor 8 96T
CSB-EL012399RA Rat Krueppel-like factor 9(KLF9) ELISA kit 96T
CSB-EL012396RA Rat Krueppel-like factor 6(KLF6) ELISA kit 96T
CH54 Recombinant Human Krueppel-like factor 6 500 ug
CSB-EL012392RA Rat Krueppel-like factor 2(KLF2) ELISA kit 96T
ant-434 Mouse Anti Human Krueppel-like factor 4 5


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur