Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

La-related protein 1B (La ribonucleoprotein domain family member 1B) (La ribonucleoprotein domain family member 2) (La-related protein 2)

 LAR1B_HUMAN             Reviewed;         914 AA.
Q659C4; Q2YDB6; Q4W599; Q4W5B2; Q659A0; Q6P5X2; Q7Z3F7; Q86VK7;
Q8N6F4; Q8N7H4; Q8NAF2; Q9H5E7; Q9NW12;
11-SEP-2007, integrated into UniProtKB/Swiss-Prot.
11-SEP-2007, sequence version 2.
18-JUL-2018, entry version 112.
RecName: Full=La-related protein 1B;
AltName: Full=La ribonucleoprotein domain family member 1B;
AltName: Full=La ribonucleoprotein domain family member 2;
AltName: Full=La-related protein 2;
Name=LARP1B; Synonyms=LARP2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 8), NUCLEOTIDE
SEQUENCE [LARGE SCALE MRNA] OF 1-634 (ISOFORM 2), NUCLEOTIDE SEQUENCE
[LARGE SCALE MRNA] OF 608-914 (ISOFORM 1), AND VARIANT ARG-462.
TISSUE=Lung, Small intestine, Teratocarcinoma, and Thyroid;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), AND
VARIANTS ARG-462 AND HIS-660.
TISSUE=Cervix, Rectum tumor, and Testis;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 6 AND 7),
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 633-914 (ISOFORM 9), AND
VARIANT HIS-660.
TISSUE=Blood, and Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[6]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19413330; DOI=10.1021/ac9004309;
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,
Mohammed S.;
"Lys-N and trypsin cover complementary parts of the phosphoproteome in
a refined SCX-based approach.";
Anal. Chem. 81:4493-4501(2009).
[7]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19369195; DOI=10.1074/mcp.M800588-MCP200;
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,
Mann M., Daub H.;
"Large-scale proteomics analysis of the human kinome.";
Mol. Cell. Proteomics 8:1751-1764(2009).
[8]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60 AND SER-432, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Leukemic T-cell;
PubMed=19690332; DOI=10.1126/scisignal.2000007;
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,
Rodionov V., Han D.K.;
"Quantitative phosphoproteomic analysis of T cell receptor signaling
reveals system-wide modulation of protein-protein interactions.";
Sci. Signal. 2:RA46-RA46(2009).
[9]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21406692; DOI=10.1126/scisignal.2001570;
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J.,
Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V.,
Blagoev B.;
"System-wide temporal characterization of the proteome and
phosphoproteome of human embryonic stem cell differentiation.";
Sci. Signal. 4:RS3-RS3(2011).
[10]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60; SER-340; SER-343 AND
THR-454, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
TISSUE=Cervix carcinoma, and Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[11]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-327; THR-329; SER-335;
SER-340; SER-343; THR-427; SER-436 AND THR-454, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
-!- INTERACTION:
O00139:KIF2A; NbExp=3; IntAct=EBI-3940258, EBI-2692369;
Q86WT6:TRIM69; NbExp=3; IntAct=EBI-3940258, EBI-749955;
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=9;
Name=1;
IsoId=Q659C4-1; Sequence=Displayed;
Name=2;
IsoId=Q659C4-2; Sequence=VSP_027642, VSP_027647;
Name=3;
IsoId=Q659C4-3; Sequence=VSP_027643, VSP_027644;
Name=4;
IsoId=Q659C4-4; Sequence=VSP_027641, VSP_027645, VSP_027646;
Name=5;
IsoId=Q659C4-5; Sequence=VSP_027640, VSP_027651;
Name=6;
IsoId=Q659C4-6; Sequence=VSP_027639, VSP_027653;
Name=7;
IsoId=Q659C4-7; Sequence=VSP_027639, VSP_027652;
Name=8;
IsoId=Q659C4-8; Sequence=VSP_027638, VSP_027650;
Name=9;
IsoId=Q659C4-9; Sequence=VSP_027648, VSP_027649;
-!- SIMILARITY: Belongs to the LARP family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAH50654.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=AAH50654.1; Type=Frameshift; Positions=753; Evidence={ECO:0000305};
Sequence=BAB15679.1; Type=Frameshift; Positions=721; Evidence={ECO:0000305};
Sequence=CAH56379.1; Type=Frameshift; Positions=113; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AK001240; BAA91576.1; -; mRNA.
EMBL; AK027164; BAB15679.1; ALT_FRAME; mRNA.
EMBL; AK092764; BAC03970.1; -; mRNA.
EMBL; AK098437; BAC05306.1; -; mRNA.
EMBL; AL137759; CAH56379.1; ALT_FRAME; mRNA.
EMBL; AL832170; CAH56210.1; -; mRNA.
EMBL; BX537937; CAD97908.1; -; mRNA.
EMBL; AC096898; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC099340; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC108045; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC114735; AAY41042.1; -; Genomic_DNA.
EMBL; AC124030; AAY41031.1; -; Genomic_DNA.
EMBL; BC030516; AAH30516.1; -; mRNA.
EMBL; BC050654; AAH50654.1; ALT_SEQ; mRNA.
EMBL; BC062606; AAH62606.1; -; mRNA.
EMBL; BC110300; AAI10301.1; -; mRNA.
CCDS; CCDS3738.1; -. [Q659C4-1]
CCDS; CCDS64057.1; -. [Q659C4-3]
RefSeq; NP_001265533.1; NM_001278604.1. [Q659C4-3]
RefSeq; NP_060548.2; NM_018078.3. [Q659C4-1]
RefSeq; NP_115615.2; NM_032239.3.
RefSeq; NP_835144.1; NM_178043.2.
RefSeq; XP_011530371.1; XM_011532069.1. [Q659C4-2]
RefSeq; XP_016863842.1; XM_017008353.1. [Q659C4-3]
UniGene; Hs.654971; -.
UniGene; Hs.657067; -.
ProteinModelPortal; Q659C4; -.
SMR; Q659C4; -.
BioGrid; 120438; 36.
DIP; DIP-47319N; -.
IntAct; Q659C4; 20.
MINT; Q659C4; -.
STRING; 9606.ENSP00000321997; -.
iPTMnet; Q659C4; -.
PhosphoSitePlus; Q659C4; -.
DMDM; 158564329; -.
EPD; Q659C4; -.
MaxQB; Q659C4; -.
PaxDb; Q659C4; -.
PeptideAtlas; Q659C4; -.
PRIDE; Q659C4; -.
ProteomicsDB; 65934; -.
ProteomicsDB; 65935; -. [Q659C4-2]
ProteomicsDB; 65936; -. [Q659C4-3]
ProteomicsDB; 65937; -. [Q659C4-4]
ProteomicsDB; 65938; -. [Q659C4-5]
ProteomicsDB; 65939; -. [Q659C4-6]
ProteomicsDB; 65940; -. [Q659C4-7]
ProteomicsDB; 65941; -. [Q659C4-8]
ProteomicsDB; 65942; -. [Q659C4-9]
DNASU; 55132; -.
Ensembl; ENST00000326639; ENSP00000321997; ENSG00000138709. [Q659C4-1]
Ensembl; ENST00000394288; ENSP00000377829; ENSG00000138709. [Q659C4-3]
GeneID; 55132; -.
KEGG; hsa:55132; -.
UCSC; uc003ify.5; human. [Q659C4-1]
CTD; 55132; -.
EuPathDB; HostDB:ENSG00000138709.17; -.
GeneCards; LARP1B; -.
HGNC; HGNC:24704; LARP1B.
HPA; HPA036280; -.
neXtProt; NX_Q659C4; -.
OpenTargets; ENSG00000138709; -.
PharmGKB; PA165664174; -.
eggNOG; KOG2590; Eukaryota.
eggNOG; COG5193; LUCA.
GeneTree; ENSGT00390000000523; -.
InParanoid; Q659C4; -.
KO; K18757; -.
OMA; YENHAYN; -.
OrthoDB; EOG091G02X0; -.
PhylomeDB; Q659C4; -.
TreeFam; TF314516; -.
ChiTaRS; LARP1B; human.
GenomeRNAi; 55132; -.
PRO; PR:Q659C4; -.
Proteomes; UP000005640; Chromosome 4.
Bgee; ENSG00000138709; -.
CleanEx; HS_LARP2; -.
ExpressionAtlas; Q659C4; baseline and differential.
Genevisible; Q659C4; HS.
GO; GO:0005634; C:nucleus; HDA:UniProtKB.
GO; GO:0003723; F:RNA binding; HDA:UniProtKB.
Gene3D; 1.10.10.10; -; 1.
InterPro; IPR006607; DM15.
InterPro; IPR006630; La_HTH.
InterPro; IPR036388; WH-like_DNA-bd_sf.
InterPro; IPR036390; WH_DNA-bd_sf.
Pfam; PF05383; La; 1.
SMART; SM00684; DM15; 3.
SMART; SM00715; LA; 1.
SUPFAM; SSF46785; SSF46785; 1.
PROSITE; PS50961; HTH_LA; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Phosphoprotein; Polymorphism;
Reference proteome; RNA-binding.
CHAIN 1 914 La-related protein 1B.
/FTId=PRO_0000299411.
DOMAIN 209 299 HTH La-type RNA-binding.
{ECO:0000255|PROSITE-ProRule:PRU00332}.
COMPBIAS 114 167 Arg-rich.
MOD_RES 60 60 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:19690332,
ECO:0000244|PubMed:21406692,
ECO:0000244|PubMed:23186163}.
MOD_RES 327 327 Phosphoserine.
{ECO:0000244|PubMed:24275569}.
MOD_RES 329 329 Phosphothreonine.
{ECO:0000244|PubMed:24275569}.
MOD_RES 335 335 Phosphoserine.
{ECO:0000244|PubMed:24275569}.
MOD_RES 340 340 Phosphoserine.
{ECO:0000244|PubMed:23186163,
ECO:0000244|PubMed:24275569}.
MOD_RES 343 343 Phosphoserine.
{ECO:0000244|PubMed:23186163,
ECO:0000244|PubMed:24275569}.
MOD_RES 427 427 Phosphothreonine.
{ECO:0000244|PubMed:24275569}.
MOD_RES 432 432 Phosphoserine.
{ECO:0000244|PubMed:19690332}.
MOD_RES 436 436 Phosphoserine.
{ECO:0000244|PubMed:24275569}.
MOD_RES 454 454 Phosphothreonine.
{ECO:0000244|PubMed:23186163,
ECO:0000244|PubMed:24275569}.
VAR_SEQ 1 790 Missing (in isoform 8).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_027638.
VAR_SEQ 1 654 Missing (in isoform 6 and isoform 7).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_027639.
VAR_SEQ 1 581 Missing (in isoform 5).
{ECO:0000303|PubMed:17974005}.
/FTId=VSP_027640.
VAR_SEQ 1 194 Missing (in isoform 4).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_027641.
VAR_SEQ 73 120 ANKHKWVPLHLDVVRSESQERPGSRNSSRCQPEANKPTHNN
RRNDTRS -> G (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_027642.
VAR_SEQ 330 335 ESAPNS -> VRVMIF (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_027643.
VAR_SEQ 336 914 Missing (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_027644.
VAR_SEQ 509 522 QEVENFKKLNLISK -> VIVSGQHLSTDALF (in
isoform 4).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_027645.
VAR_SEQ 523 914 Missing (in isoform 4).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_027646.
VAR_SEQ 550 561 Missing (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_027647.
VAR_SEQ 771 787 YGLECLFRFYSYGLEKK -> SAVWTRKVLGLFEIFSI
(in isoform 9).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_027648.
VAR_SEQ 788 914 Missing (in isoform 9).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_027649.
VAR_SEQ 791 806 EIFQDFQEETKKDYES -> MRNLDNLLGKMQKKIT (in
isoform 8).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_027650.
VAR_SEQ 850 914 PPISDEFGRKRHSSTSGEESNRHRLPPNSSTKPPNAAKPTS
TSELQVPINSPRRNISPESSDNSH -> NHHDRLLLLIINI
(in isoform 5).
{ECO:0000303|PubMed:17974005}.
/FTId=VSP_027651.
VAR_SEQ 850 914 PPISDEFGRKRHSSTSGEESNRHRLPPNSSTKPPNAAKPTS
TSELQVPINSPRRNISPESSDNSH -> EADPIE (in
isoform 7).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_027652.
VAR_SEQ 896 914 VPINSPRRNISPESSDNSH -> EADPIE (in isoform
6). {ECO:0000303|PubMed:15489334}.
/FTId=VSP_027653.
VARIANT 462 462 P -> R (in dbSNP:rs12508837).
{ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:17974005}.
/FTId=VAR_034813.
VARIANT 660 660 R -> H (in dbSNP:rs12645577).
{ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:17974005}.
/FTId=VAR_034814.
CONFLICT 272 272 A -> V (in Ref. 1; BAC03970).
{ECO:0000305}.
CONFLICT 289 289 K -> E (in Ref. 1; BAA91576).
{ECO:0000305}.
CONFLICT 291 291 E -> T (in Ref. 1; BAC05306).
{ECO:0000305}.
CONFLICT 473 473 R -> Q (in Ref. 1; BAC03970).
{ECO:0000305}.
CONFLICT 639 639 T -> A (in Ref. 2; CAD97908).
{ECO:0000305}.
CONFLICT 671 671 N -> S (in Ref. 4; AAH62606).
{ECO:0000305}.
SEQUENCE 914 AA; 105322 MW; A06968F316A432BC CRC64;
MENWPTPSEL VNTGFQSVLS QGNKKPQNRK EKEEKVEKRS NSDSKENRET KLNGPGENVS
EDEAQSSNQR KRANKHKWVP LHLDVVRSES QERPGSRNSS RCQPEANKPT HNNRRNDTRS
WKRDREKRDD QDDVSSVRSE GGNIRGSFRG RGRGRGRGRG RGRGNPRLNF DYSYGYQEHG
ERTDQPFQTE LNTSMMYYYD DGTGVQVYPV EEALLKEYIK RQIEYYFSVE NLERDFFLRG
KMDEQGFLPI SLIAGFQRVQ ALTTNLNLIL EALKDSTEVE IVDEKMRKKI EPEKWPIPGP
PPRSVPPTDF SQLIDCPEFV PGQAFCSHTE SAPNSPRIGS PLSPKKNSET SILQAMSRGL
STSLPDLDSE PWIEVKKRHQ PAPVKLRESV SVPEGSLNQL CSSEEPEQEE LDFLFDEEIE
QIGRKNTFTD WSDNDSDYEI DDQDLNKILI VTQTPPYVKK HPGGDRTGTH MSRAKITSEL
AKVINDGLYY YEQDLWMEED ENKHTAIKQE VENFKKLNLI SKEQFENLTP ELPFEPNQEV
PVAPSQSRQG GVQGVLHIPK KDLTDELAQK LFDVSEITSA AMVHSLPTAV PESPRIHPTR
TPKTPRTPRL QDPNKTPRFY PVVKEPKAID VKSPRKRKTR HSTNPPLECH VGWVMDSRDR
GPGTSSVSTS NASPSEGAPL AGSYGCTPHS FPKFQHPSHE LLKENGFTQQ VYHKYRRRCL
SERKRLGIGQ SQEMNTLFRF WSFFLRDHFN KKMYEEFRQL AWEDAKENYR YGLECLFRFY
SYGLEKKFRR EIFQDFQEET KKDYESGQLY GLEKFWAYLK YSQSKTQSID PKLQEYLCSF
KRLEDFRVDP PISDEFGRKR HSSTSGEESN RHRLPPNSST KPPNAAKPTS TSELQVPINS
PRRNISPESS DNSH


Related products :

Catalog number Product name Quantity
18-003-44221 La-related protein 7 - La ribonucleoprotein domain family member 7 Polyclonal 0.1 mg Protein A
18-003-42544 La-related protein 1 - La ribonucleoprotein domain family member 1 Polyclonal 0.1 mg Protein A
EIAAB35653 60 kDa ribonucleoprotein Ro,60 kDa Ro protein,60 kDa SS-A_Ro ribonucleoprotein,Mouse,Mus musculus,RoRNP,Ssa2,TROVE domain family member 2,Trove2
18-003-43599 60 kDa SS-A_Ro ribonucleoprotein - 60 kDa Ro protein; 60 kDa ribonucleoprotein Ro; RoRNP; Ro 60 kDa autoantigen; TROVE domain family member 2; Sjoegren syndrome type A antigen; SS-A; Sjoegren syndrome 0.1 mg Protein A
18-003-43600 60 kDa SS-A_Ro ribonucleoprotein - 60 kDa Ro protein; 60 kDa ribonucleoprotein Ro; RoRNP; Ro 60 kDa autoantigen; TROVE domain family member 2; Sjoegren syndrome type A antigen; SS-A; Sjoegren syndrome 0.05 mg Aff Pur
10-663-45616 RO-60_SS-A Human - 60 kDa Ro protein; 60 kDa ribonucleoprotein Ro; RoRNP; TROVE domain family member 2 N_A 0.01 mg
10-663-45616 RO-60_SS-A Human - 60 kDa Ro protein; 60 kDa ribonucleoprotein Ro; RoRNP; TROVE domain family member 2 N_A 0.05 mg
10-663-45616 RO-60_SS-A Human - 60 kDa Ro protein; 60 kDa ribonucleoprotein Ro; RoRNP; TROVE domain family member 2 N_A 1 mg
EIAAB31260 Mouse,Mus musculus,PH domain-containing adaptor PHAD47,PH domain-containing family A member 2,Pleckstrin homology domain-containing family A member 2,Plekha2,Tandem PH domain-containing protein 2,Tapp
EIAAB31257 Homo sapiens,Human,PH domain-containing family A member 1,Pleckstrin homology domain-containing family A member 1,PLEKHA1,Tandem PH domain-containing protein 1,TAPP1,TAPP-1
EIAAB31259 Homo sapiens,Human,PH domain-containing family A member 2,Pleckstrin homology domain-containing family A member 2,PLEKHA2,Tandem PH domain-containing protein 2,TAPP2,TAPP-2
EIAAB30917 Kiaa0606,Mouse,Mus musculus,PH domain leucine-rich repeat-containing protein phosphatase 1,PH domain-containing family E member 1,Phlpp,Phlpp1,Pleckstrin homology domain-containing family E member 1,P
EIAAB31258 Mouse,Mus musculus,PH domain-containing family A member 1,Pleckstrin homology domain-containing family A member 1,Plekha1,Tandem PH domain-containing protein 1,Tapp1,TAPP-1
EIAAB30916 PH domain leucine-rich repeat protein phosphatase 1,PH domain-containing family E member 1,Phlpp,Phlpp1,Pleckstrin homology domain-containing family E member 1,Plekhe1,Rat,Rattus norvegicus,Scop,Supra
E2849h Human La Ribonucleoprotein Domain Family, Member 1 96T
E14792h Human La Ribonucleoprotein Domain Family, Member 7 96T
E14791h Human La Ribonucleoprotein Domain Family, Member 6 96T
E7558h Human La Ribonucleoprotein Domain Family, Member 5 96T
E6911h Human La Ribonucleoprotein Domain Family, Member 4 96T
GWB-B15B2B LARP2 (La ribonucleoprotein domain family. member 2)
GWB-4991C1 LARP7 (La ribonucleoprotein domain family. member 7)
E6963h Human La Ribonucleoprotein Domain Family, Member 2 96T
EIAAB31286 Homo sapiens,Human,PH and FYVE domain-containing protein 2,PH domain-containing family F member 2,Phafin-2,Pleckstrin homology domain-containing family F member 2,PLEKHF2,ZFYVE18,Zinc finger FYVE doma
LARP4 LARP1 Gene La ribonucleoprotein domain family, member 1
LARP6 LARP4 Gene La ribonucleoprotein domain family, member 4


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur