Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Leukocyte immunoglobulin-like receptor subfamily A member 5 (CD85 antigen-like family member F) (Immunoglobulin-like transcript 11) (ILT-11) (Leukocyte immunoglobulin-like receptor 9) (LIR-9) (CD antigen CD85f)

 LIRA5_HUMAN             Reviewed;         299 AA.
A6NI73; A6NHI3;
26-FEB-2008, integrated into UniProtKB/Swiss-Prot.
24-JUL-2007, sequence version 1.
23-MAY-2018, entry version 92.
RecName: Full=Leukocyte immunoglobulin-like receptor subfamily A member 5;
AltName: Full=CD85 antigen-like family member F;
AltName: Full=Immunoglobulin-like transcript 11;
Short=ILT-11;
AltName: Full=Leukocyte immunoglobulin-like receptor 9;
Short=LIR-9;
AltName: CD_antigen=CD85f;
Flags: Precursor;
Name=LILRA5; Synonyms=ILT11, LILRB7, LIR9;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=10941842; DOI=10.1007/s002510000187;
Wende H., Volz A., Ziegler A.;
"Extensive gene duplications and a large inversion characterize the
human leukocyte receptor cluster.";
Immunogenetics 51:703-713(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), TISSUE
SPECIFICITY, AND SUBCELLULAR LOCATION.
PubMed=12393390; DOI=10.1182/blood-2002-05-1432;
Borges L., Kubin M., Kuhlman T.;
"LIR9, an immunoglobulin-superfamily-activating receptor, is expressed
as a transmembrane and as a secreted molecule.";
Blood 101:1484-1486(2003).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15057824; DOI=10.1038/nature02399;
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J.,
Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M.,
Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E.,
Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M.,
Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C.,
Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M.,
Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T.,
Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H.,
Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S.,
Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J.,
Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M.,
Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J.,
Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D.,
Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A.,
Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I.,
Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E.,
Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M.,
Rubin E.M., Lucas S.M.;
"The DNA sequence and biology of human chromosome 19.";
Nature 428:529-535(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[5]
X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 42-237, FUNCTION, AND
DISULFIDE BOND.
PubMed=16675463; DOI=10.1074/jbc.M603076200;
Shiroishi M., Kajikawa M., Kuroki K., Ose T., Kohda D., Maenaka K.;
"Crystal structure of the human monocyte-activating receptor, 'Group
2' leukocyte Ig-like receptor A5 (LILRA5/LIR9/ILT11).";
J. Biol. Chem. 281:19536-19544(2006).
-!- FUNCTION: May play a role in triggering innate immune responses.
Does not seem to play a role for any class I MHC antigen
recognition. {ECO:0000269|PubMed:16675463}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:12393390};
Single-pass type I membrane protein {ECO:0000255}.
-!- SUBCELLULAR LOCATION: Isoform 3: Secreted
{ECO:0000269|PubMed:12393390}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1; Synonyms=LIR9m1;
IsoId=A6NI73-1; Sequence=Displayed;
Name=2; Synonyms=LIR9m2;
IsoId=A6NI73-2; Sequence=VSP_031276;
Name=3; Synonyms=LIR9s1;
IsoId=A6NI73-3; Sequence=VSP_031277;
Name=4; Synonyms=LIR9s2;
IsoId=A6NI73-4; Sequence=VSP_031276, VSP_031277;
-!- TISSUE SPECIFICITY: Expressed mostly in tissues of the
hematopoietic system, including bone marrow, spleen, lymph node
and peripheral leukocytes. Among leukocytes, monocytes and
neutrophils express the highest level. Expressed in CD14+
monocytes, but not in T-cells, B-cells or natural killer (NK)
cells (at protein level). {ECO:0000269|PubMed:12393390}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF212842; AAF73849.1; -; mRNA.
EMBL; AF324830; AAK52451.1; -; mRNA.
EMBL; AF499916; AAN27925.1; -; mRNA.
EMBL; AF499917; AAN27926.1; -; mRNA.
EMBL; AF499918; AAN27927.1; -; mRNA.
EMBL; AF499919; AAN27928.1; -; mRNA.
EMBL; AC008984; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471135; EAW72226.1; -; Genomic_DNA.
EMBL; CH471135; EAW72227.1; -; Genomic_DNA.
CCDS; CCDS12888.1; -. [A6NI73-1]
CCDS; CCDS12889.1; -. [A6NI73-2]
RefSeq; NP_067073.1; NM_021250.3. [A6NI73-1]
RefSeq; NP_870994.1; NM_181879.2. [A6NI73-3]
RefSeq; NP_871714.1; NM_181985.3. [A6NI73-2]
RefSeq; NP_871715.1; NM_181986.2. [A6NI73-4]
UniGene; Hs.710986; -.
PDB; 2D3V; X-ray; 1.85 A; A=42-237.
PDBsum; 2D3V; -.
ProteinModelPortal; A6NI73; -.
SMR; A6NI73; -.
STRING; 9606.ENSP00000301219; -.
iPTMnet; A6NI73; -.
PhosphoSitePlus; A6NI73; -.
BioMuta; LILRA5; -.
PaxDb; A6NI73; -.
PRIDE; A6NI73; -.
DNASU; 353514; -.
Ensembl; ENST00000432233; ENSP00000404236; ENSG00000187116. [A6NI73-1]
Ensembl; ENST00000486742; ENSP00000484372; ENSG00000187116. [A6NI73-2]
Ensembl; ENST00000611164; ENSP00000482658; ENSG00000278355. [A6NI73-2]
Ensembl; ENST00000612266; ENSP00000480436; ENSG00000274914. [A6NI73-4]
Ensembl; ENST00000612621; ENSP00000484785; ENSG00000278355. [A6NI73-1]
Ensembl; ENST00000613559; ENSP00000484775; ENSG00000274914. [A6NI73-3]
Ensembl; ENST00000614299; ENSP00000483992; ENSG00000274914. [A6NI73-2]
Ensembl; ENST00000615820; ENSP00000480204; ENSG00000274113. [A6NI73-2]
Ensembl; ENST00000616133; ENSP00000484062; ENSG00000275404. [A6NI73-4]
Ensembl; ENST00000618711; ENSP00000478354; ENSG00000274914. [A6NI73-1]
Ensembl; ENST00000619516; ENSP00000480382; ENSG00000278355. [A6NI73-4]
Ensembl; ENST00000620091; ENSP00000480458; ENSG00000274113. [A6NI73-1]
Ensembl; ENST00000620692; ENSP00000483958; ENSG00000275404. [A6NI73-3]
Ensembl; ENST00000620898; ENSP00000484869; ENSG00000275404. [A6NI73-2]
Ensembl; ENST00000621042; ENSP00000482882; ENSG00000275404. [A6NI73-1]
Ensembl; ENST00000621482; ENSP00000477785; ENSG00000278355. [A6NI73-3]
GeneID; 353514; -.
KEGG; hsa:353514; -.
UCSC; uc032idp.1; human. [A6NI73-1]
CTD; 353514; -.
DisGeNET; 353514; -.
EuPathDB; HostDB:ENSG00000187116.13; -.
GeneCards; LILRA5; -.
HGNC; HGNC:16309; LILRA5.
MIM; 606047; gene.
neXtProt; NX_A6NI73; -.
OpenTargets; ENSG00000187116; -.
PharmGKB; PA142671547; -.
eggNOG; ENOG410JB9F; Eukaryota.
eggNOG; ENOG41114EZ; LUCA.
GeneTree; ENSGT00760000119033; -.
HOGENOM; HOG000234395; -.
HOVERGEN; HBG074353; -.
InParanoid; A6NI73; -.
KO; K06512; -.
OMA; ILIFQDW; -.
OrthoDB; EOG091G0D6W; -.
PhylomeDB; A6NI73; -.
TreeFam; TF336644; -.
Reactome; R-HSA-198933; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
EvolutionaryTrace; A6NI73; -.
GenomeRNAi; 353514; -.
PRO; PR:A6NI73; -.
Proteomes; UP000005640; Chromosome 19.
Bgee; ENSG00000187116; -.
CleanEx; HS_LILRA5; -.
Genevisible; A6NI73; HS.
GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005886; C:plasma membrane; IEA:UniProtKB-SubCell.
GO; GO:0045087; P:innate immune response; IEA:UniProtKB-KW.
Gene3D; 2.60.40.10; -; 2.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003599; Ig_sub.
InterPro; IPR003598; Ig_sub2.
Pfam; PF13895; Ig_2; 1.
SMART; SM00409; IG; 2.
SMART; SM00408; IGc2; 1.
SUPFAM; SSF48726; SSF48726; 2.
1: Evidence at protein level;
3D-structure; Alternative splicing; Cell membrane; Complete proteome;
Disulfide bond; Glycoprotein; Immunity; Immunoglobulin domain;
Innate immunity; Membrane; Receptor; Reference proteome; Repeat;
Secreted; Signal; Transmembrane; Transmembrane helix.
SIGNAL 1 41 {ECO:0000255}.
CHAIN 42 299 Leukocyte immunoglobulin-like receptor
subfamily A member 5.
/FTId=PRO_0000318708.
TOPO_DOM 42 268 Extracellular. {ECO:0000255}.
TRANSMEM 269 289 Helical. {ECO:0000255}.
TOPO_DOM 290 299 Cytoplasmic. {ECO:0000255}.
DOMAIN 51 136 Ig-like C2-type 1.
DOMAIN 142 230 Ig-like C2-type 2.
CARBOHYD 43 43 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 157 157 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 248 248 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 67 116 {ECO:0000244|PDB:2D3V,
ECO:0000269|PubMed:16675463}.
DISULFID 162 214 {ECO:0000244|PDB:2D3V,
ECO:0000269|PubMed:16675463}.
VAR_SEQ 31 42 Missing (in isoform 2 and isoform 4).
{ECO:0000303|PubMed:12393390}.
/FTId=VSP_031276.
VAR_SEQ 239 299 AADNLSPSQNKSDSGTASHLQDYAVENLIRMGMAGLILVVL
GILIFQDWHSQRSPQAAAGR -> EEATVFSSTIQGSQTGC
GELYRQGSPC (in isoform 3 and isoform 4).
{ECO:0000303|PubMed:12393390}.
/FTId=VSP_031277.
CONFLICT 100 100 R -> G (in Ref. 1; AAF73849).
{ECO:0000305}.
CONFLICT 220 220 H -> R (in Ref. 1; AAF73849).
{ECO:0000305}.
STRAND 48 53 {ECO:0000244|PDB:2D3V}.
STRAND 55 58 {ECO:0000244|PDB:2D3V}.
STRAND 63 68 {ECO:0000244|PDB:2D3V}.
STRAND 75 80 {ECO:0000244|PDB:2D3V}.
STRAND 87 90 {ECO:0000244|PDB:2D3V}.
STRAND 98 105 {ECO:0000244|PDB:2D3V}.
HELIX 108 110 {ECO:0000244|PDB:2D3V}.
STRAND 112 120 {ECO:0000244|PDB:2D3V}.
STRAND 131 136 {ECO:0000244|PDB:2D3V}.
STRAND 143 145 {ECO:0000244|PDB:2D3V}.
STRAND 159 166 {ECO:0000244|PDB:2D3V}.
STRAND 169 175 {ECO:0000244|PDB:2D3V}.
STRAND 182 186 {ECO:0000244|PDB:2D3V}.
STRAND 195 200 {ECO:0000244|PDB:2D3V}.
STRAND 210 218 {ECO:0000244|PDB:2D3V}.
STRAND 221 225 {ECO:0000244|PDB:2D3V}.
STRAND 232 234 {ECO:0000244|PDB:2D3V}.
SEQUENCE 299 AA; 32755 MW; F5EE25361D4E0F02 CRC64;
MAPWSHPSAQ LQPVGGDAVS PALMVLLCLG LSLGPRTHVQ AGNLSKATLW AEPGSVISRG
NSVTIRCQGT LEAQEYRLVK EGSPEPWDTQ NPLEPKNKAR FSIPSMTEHH AGRYRCYYYS
PAGWSEPSDP LELVVTGFYN KPTLSALPSP VVTSGENVTL QCGSRLRFDR FILTEEGDHK
LSWTLDSQLT PSGQFQALFP VGPVTPSHRW MLRCYGSRRH ILQVWSEPSD LLEIPVSGAA
DNLSPSQNKS DSGTASHLQD YAVENLIRMG MAGLILVVLG ILIFQDWHSQ RSPQAAAGR


Related products :

Catalog number Product name Quantity
C485 Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 2 LIR-2 lmg
C484 Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 1 LIR-1 500
C485 Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 2 LIR-2 500
C484 Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 1 LIR-1 lmg
EIAAB07931 CD300 antigen-like family member F,Cd300lf,Clm1,CLM-1,CMRF35-like molecule 1,Leukocyte mono-Ig-like receptor 3,Lmir3,MAIR-5,MAIR-V,Mouse,Mus musculus,Myeloid-associated immunoglobulin-like receptor 5
EH2451 Leukocyte immunoglobulin-like receptor subfamily A member 2 Elisa Kit 96T
EH2323 Leukocyte immunoglobulin-like receptor subfamily B member 4 Elisa Kit 96T
EH2371 Leukocyte immunoglobulin-like receptor subfamily B member 2 Elisa Kit 96T
CA47 Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2 LILRA2 500
C485 Human Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 1 LIR-1 l0
EH2452 Leukocyte immunoglobulin-like receptor subfamily B member 1 Elisa Kit 96T
CG18 Human Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 2 LIR-2 l0
C369 Human Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 2 LIR-2 50
CA47 Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2 LILRA2 lmg
CG18 Human Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 1 LIR-1 50
EIAAB07943 CD300 antigen-like family member A,Cd300a,Clm8,CLM-8,CMRF35-like molecule 8,Leukocyte mono-Ig-like receptor 1,Lmir1,MAIR-1,MAIR-I,Mast cell-derived paired immunoglobulin-like receptor 1,Mcpir1,Mouse,M
E91399Hu ELISA Kit for Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 (LILRB4) 96T/Kit
E0560r Human ELISA Kit FOR Leukocyte immunoglobulin-like receptor subfamily A member 4 96T
E0161d Human ELISA Kit FOR Leukocyte immunoglobulin-like receptor subfamily B member 5 96T
C485 Human Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2 LILRA2 50
GKN3_MOUSE Human ELISA Kit FOR Leukocyte immunoglobulin-like receptor subfamily B member 5 96T
C484 Human Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2 LILRA2 l0
TCF19_PIG Human ELISA Kit FOR Leukocyte immunoglobulin-like receptor subfamily B member 5 96T
E91387Hu ELISA Kit for Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3) 96T/Kit
HIC1_HUMAN Human ELISA Kit FOR Leukocyte immunoglobulin-like receptor subfamily A member 4 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur