Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Luc7-like protein 3 (Cisplatin resistance-associated-overexpressed protein)

 LC7L3_MOUSE             Reviewed;         432 AA.
Q5SUF2; Q3U9D5; Q8BUJ5; Q921Z3; Q9CRS7; Q9CTY4;
02-MAY-2006, integrated into UniProtKB/Swiss-Prot.
21-DEC-2004, sequence version 1.
22-NOV-2017, entry version 109.
RecName: Full=Luc7-like protein 3;
AltName: Full=Cisplatin resistance-associated-overexpressed protein;
Name=Luc7l3; Synonyms=Crop;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE
SEQUENCE [LARGE SCALE MRNA] OF 1-252 (ISOFORMS 1/2/3), AND NUCLEOTIDE
SEQUENCE [LARGE SCALE MRNA] OF 165-432 (ISOFORM 1).
STRAIN=C57BL/6J;
TISSUE=Embryonic head, Embryonic heart, Macrophage, and Placenta;
PubMed=16141072; DOI=10.1126/science.1112014;
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M.,
Davis M.J., Wilming L.G., Aidinis V., Allen J.E.,
Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L.,
Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M.,
Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R.,
Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G.,
di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G.,
Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M.,
Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N.,
Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T.,
Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H.,
Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K.,
Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J.,
Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L.,
Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K.,
Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P.,
Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O.,
Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G.,
Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M.,
Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B.,
Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K.,
Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A.,
Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K.,
Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C.,
Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J.,
Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y.,
Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T.,
Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N.,
Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N.,
Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S.,
Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J.,
Hayashizaki Y.;
"The transcriptional landscape of the mammalian genome.";
Science 309:1559-1563(2005).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=C57BL/6J;
PubMed=19468303; DOI=10.1371/journal.pbio.1000112;
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S.,
She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W.,
Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T.,
Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J.,
Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z.,
Lindblad-Toh K., Eichler E.E., Ponting C.P.;
"Lineage-specific biology revealed by a finished genome assembly of
the mouse.";
PLoS Biol. 7:E1000112-E1000112(2009).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
STRAIN=FVB/N; TISSUE=Mammary tumor;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-425 AND SER-431, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=17242355; DOI=10.1073/pnas.0609836104;
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.;
"Large-scale phosphorylation analysis of mouse liver.";
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007).
[5]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-420; SER-425 AND
SER-431, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
TISSUE=Brain, Heart, Kidney, Liver, Lung, Pancreas, Spleen, and
Testis;
PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
"A tissue-specific atlas of mouse protein phosphorylation and
expression.";
Cell 143:1174-1189(2010).
-!- FUNCTION: Binds cAMP regulatory element DNA sequence. May play a
role in RNA splicing (By similarity). {ECO:0000250}.
-!- SUBUNIT: May interact with SFRS1 and form homodimers. Interacts
with JMJD6. Interacts with RBM25. Interacts with RSRC1 (via
Arg/Ser-rich domain). Interacts with RRP1B.
{ECO:0000250|UniProtKB:O95232}.
-!- SUBCELLULAR LOCATION: Nucleus speckle {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q5SUF2-1; Sequence=Displayed;
Name=2;
IsoId=Q5SUF2-2; Sequence=VSP_018138;
Name=3;
IsoId=Q5SUF2-3; Sequence=VSP_018139;
-!- SIMILARITY: Belongs to the Luc7 family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AK014362; BAB29297.1; -; mRNA.
EMBL; AK019464; BAB31736.1; -; mRNA.
EMBL; AK084714; BAC39261.1; -; mRNA.
EMBL; AK151228; BAE30220.1; -; mRNA.
EMBL; AK151839; BAE30732.1; -; mRNA.
EMBL; AL645846; CAI24700.1; -; Genomic_DNA.
EMBL; AL645965; CAI24700.1; JOINED; Genomic_DNA.
EMBL; AL645846; CAI24701.1; -; Genomic_DNA.
EMBL; AL645965; CAI24701.1; JOINED; Genomic_DNA.
EMBL; AL645965; CAI25943.1; -; Genomic_DNA.
EMBL; AL645846; CAI25943.1; JOINED; Genomic_DNA.
EMBL; AL645965; CAI25944.1; -; Genomic_DNA.
EMBL; AL645846; CAI25944.1; JOINED; Genomic_DNA.
EMBL; BC009092; AAH09092.1; -; mRNA.
CCDS; CCDS25252.1; -. [Q5SUF2-2]
RefSeq; NP_080589.1; NM_026313.1. [Q5SUF2-2]
RefSeq; XP_006534073.1; XM_006534010.3. [Q5SUF2-1]
RefSeq; XP_006534074.1; XM_006534011.3. [Q5SUF2-1]
UniGene; Mm.30927; -.
ProteinModelPortal; Q5SUF2; -.
SMR; Q5SUF2; -.
BioGrid; 212365; 3.
IntAct; Q5SUF2; 2.
MINT; MINT-1549603; -.
STRING; 10090.ENSMUSP00000021226; -.
iPTMnet; Q5SUF2; -.
PhosphoSitePlus; Q5SUF2; -.
EPD; Q5SUF2; -.
PaxDb; Q5SUF2; -.
PeptideAtlas; Q5SUF2; -.
PRIDE; Q5SUF2; -.
Ensembl; ENSMUST00000021226; ENSMUSP00000021226; ENSMUSG00000020863. [Q5SUF2-2]
Ensembl; ENSMUST00000107820; ENSMUSP00000103450; ENSMUSG00000020863. [Q5SUF2-1]
Ensembl; ENSMUST00000107821; ENSMUSP00000103451; ENSMUSG00000020863. [Q5SUF2-1]
Ensembl; ENSMUST00000166312; ENSMUSP00000129919; ENSMUSG00000020863. [Q5SUF2-3]
GeneID; 67684; -.
KEGG; mmu:67684; -.
UCSC; uc007kyh.1; mouse. [Q5SUF2-2]
UCSC; uc007kyi.1; mouse. [Q5SUF2-1]
UCSC; uc007kyj.1; mouse. [Q5SUF2-3]
CTD; 51747; -.
MGI; MGI:1914934; Luc7l3.
eggNOG; KOG0796; Eukaryota.
eggNOG; COG5200; LUCA.
GeneTree; ENSGT00730000110670; -.
HOGENOM; HOG000215956; -.
HOVERGEN; HBG062167; -.
InParanoid; Q5SUF2; -.
OMA; MGKQHVG; -.
OrthoDB; EOG091G0HXI; -.
PhylomeDB; Q5SUF2; -.
TreeFam; TF354312; -.
ChiTaRS; Luc7l3; mouse.
PRO; PR:Q5SUF2; -.
Proteomes; UP000000589; Chromosome 11.
Bgee; ENSMUSG00000020863; -.
CleanEx; MM_3300001P08RIK; -.
ExpressionAtlas; Q5SUF2; baseline and differential.
Genevisible; Q5SUF2; MM.
GO; GO:0016607; C:nuclear speck; ISO:MGI.
GO; GO:0005654; C:nucleoplasm; ISO:MGI.
GO; GO:0005634; C:nucleus; ISS:UniProtKB.
GO; GO:0005685; C:U1 snRNP; IBA:GO_Central.
GO; GO:0071004; C:U2-type prespliceosome; IBA:GO_Central.
GO; GO:0003677; F:DNA binding; IEA:UniProtKB-KW.
GO; GO:0003729; F:mRNA binding; ISS:UniProtKB.
GO; GO:0003723; F:RNA binding; ISO:MGI.
GO; GO:0006376; P:mRNA splice site selection; IBA:GO_Central.
GO; GO:0008380; P:RNA splicing; ISS:UniProtKB.
InterPro; IPR004882; Luc7-rel.
PANTHER; PTHR12375; PTHR12375; 2.
Pfam; PF03194; LUC7; 1.
1: Evidence at protein level;
Acetylation; Alternative splicing; Coiled coil; Complete proteome;
DNA-binding; Isopeptide bond; mRNA processing; mRNA splicing; Nucleus;
Phosphoprotein; Reference proteome; Ubl conjugation.
CHAIN 1 432 Luc7-like protein 3.
/FTId=PRO_0000233411.
COILED 124 181 {ECO:0000255}.
COMPBIAS 228 282 Glu-rich.
COMPBIAS 235 395 Arg/Ser-rich.
MOD_RES 1 1 N-acetylmethionine.
{ECO:0000250|UniProtKB:O95232}.
MOD_RES 3 3 Phosphoserine.
{ECO:0000250|UniProtKB:O95232}.
MOD_RES 110 110 Phosphoserine.
{ECO:0000250|UniProtKB:O95232}.
MOD_RES 115 115 Phosphoserine.
{ECO:0000250|UniProtKB:O95232}.
MOD_RES 231 231 N6-acetyllysine.
{ECO:0000250|UniProtKB:O95232}.
MOD_RES 420 420 Phosphoserine.
{ECO:0000244|PubMed:21183079}.
MOD_RES 425 425 Phosphoserine.
{ECO:0000244|PubMed:17242355,
ECO:0000244|PubMed:21183079}.
MOD_RES 431 431 Phosphoserine.
{ECO:0000244|PubMed:17242355,
ECO:0000244|PubMed:21183079}.
CROSSLNK 424 424 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO1).
{ECO:0000250|UniProtKB:O95232}.
CROSSLNK 424 424 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:O95232}.
VAR_SEQ 427 432 GDTQSN -> VQRKYAQMKMELSRVRRHTKASSEGKDSVVL
QNILRYIVLSQLFCSRLRAPISVPLWKLLSTYVI (in
isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_018138.
VAR_SEQ 427 432 GDTQSN -> VQRKYAQMKMELSRVRRHTKASSEGKDSVVL
QNILRTTVEEFLKNTENGIK (in isoform 3).
{ECO:0000303|PubMed:16141072}.
/FTId=VSP_018139.
CONFLICT 402 402 D -> E (in Ref. 1; BAC39261).
{ECO:0000305}.
SEQUENCE 432 AA; 51450 MW; 2546F0AE9A0CC160 CRC64;
MISAAQLLDE LMGRDRNLAP DEKRSNVRWD HESVCKYYLC GFCPAELFTN TRSDLGPCEK
IHDENLRKQY EKSSRFMKVG YERDFLRYLQ SLLAEVERRI RRGHARLALS QNQQSSGAAG
PTGKNEEKIQ VLTDKIDVLL QQIEELGSEG KVEEAQGMMK LVEQLKEERE LLRSTTSTIE
SFAAQEKQME VCEVCGAFLI VGDAQSRVDD HLMGKQHMGY AKIKATVEEL KEKLRKRTEE
PDRDERLKKE KQEREEREKE REREREERER KRRREEEERE KERARDRERR KRSRSRSRHS
SRTSDRRCSR SRDHKRSRSR DRRRSRSRDR RRSRSHDRSE RKHRSRSRDR RRSKSRDRKS
YKHRSKSRDR EQDRKSKEKE KKGSDDKKSS VKSSSREKQS EDTNPESKES DTKNEVNGTS
EDIKSEGDTQ SN


Related products :

Catalog number Product name Quantity
E02C0617 Rat Cisplatin Resistance Associated Overexpressed Protein ELISA 96T/kit
E07C0617 Porcine Cisplatin Resistance Associated Overexpressed Protein ELISA 96T/kit
E01C0617 Human Cisplatin Resistance Associated Overexpressed Protein ELISA 96T/kit
E14C0617 Sheep Cisplatin Resistance Associated Overexpressed Protein ELISA 96T/kit
E11C0617 Bovine Cisplatin Resistance Associated Overexpressed Protein ELISA 96T/kit
E09C0617 Monkey Cisplatin Resistance Associated Overexpressed Protein ELISA 96T/kit
E06C0617 Goat Cisplatin Resistance Associated Overexpressed Protein ELISA 96T/kit
E04C0617 Rabbit Cisplatin Resistance Associated Overexpressed Protein ELISA 96T/kit
E03C0617 Mouse Cisplatin Resistance Associated Overexpressed Protein ELISA 96T/kit
E02C0617 Rat Cisplatin Resistance Associated Overexpressed Protein ELISA, CROP 96 Tests/kit
E-EL-R0208 Rat CROP (Cisplatin Resistance Associated Overexpressed Protein) ELISA Kit 96T
E12C0617 Chicken Cisplatin Resistance Associated Overexpressed Protein ELISA 96T/kit
E08C0617 Canine Cisplatin Resistance Associated Overexpressed Protein ELISA 96T/kit
E02C0617 Rat Cisplatin Resistance Associated Overexpressed Protein Elisa Kit (CROP) 96 Tests/kit
E02C0617 Rat Cisplatin Resistance Associated Overexpressed Protein ELISA, CROP
E05C0617 Guinea Pig Cisplatin Resistance Associated Overexpressed Protein ELISA 96T/kit
E06C0617 Goat Cisplatin Resistance Associated Overexpressed Protein Elisa Kit (CROP) 96 Tests/kit
E12C0617 Chicken Cisplatin Resistance Associated Overexpressed Protein ELISA, CROP
E14C0617 Sheep Cisplatin Resistance Associated Overexpressed Protein ELISA, CROP
E08C0617 Canine Cisplatin Resistance Associated Overexpressed Protein Elisa Kit (CROP) 96 Tests/kit
E07C0617 Porcine Cisplatin Resistance Associated Overexpressed Protein Elisa Kit (CROP) 96 Tests/kit
E13C0617 Anserine Cisplatin Resistance Associated Overexpressed Protein Elisa Kit (CROP) 96 Tests/kit
E11C0617 Bovine Cisplatin Resistance Associated Overexpressed Protein ELISA, CROP 96 Tests/kit
E02C0617 Rat anti-Cisplatin Resistance Associated Overexpressed Protein Elisa Kit (CROP) 96 Tests/kit
E05C0617 Guinea Cisplatin Resistance Associated Overexpressed Protein Elisa Kit (CROP) 96 Tests/kit


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur