Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Lymphocyte antigen 75 (Ly-75) (C-type lectin domain family 13 member B) (DEC-205) (gp200-MR6) (CD antigen CD205)

 LY75_HUMAN              Reviewed;        1722 AA.
O60449; O75913; Q53R46; Q53TF5; Q7Z575; Q7Z577;
19-SEP-2003, integrated into UniProtKB/Swiss-Prot.
11-JAN-2011, sequence version 3.
25-APR-2018, entry version 157.
RecName: Full=Lymphocyte antigen 75;
Short=Ly-75;
AltName: Full=C-type lectin domain family 13 member B;
AltName: Full=DEC-205;
AltName: Full=gp200-MR6;
AltName: CD_antigen=CD205;
Flags: Precursor;
Name=LY75; Synonyms=CD205, CLEC13B;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606 {ECO:0000312|EMBL:AAC17636.1};
[1] {ECO:0000305}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), PARTIAL PROTEIN SEQUENCE,
TISSUE SPECIFICITY, GLYCOSYLATION, AND VARIANTS ASP-268 AND GLU-807.
TISSUE=Thymus;
PubMed=9862343;
DOI=10.1002/(SICI)1521-4141(199812)28:12<4071::AID-IMMU4071>3.0.CO;2-O;
McKay P.F., Imami N., Johns M., Taylor-Fishwick D.A., Sedibane L.M.,
Totty N.F., Hsuan J.J., Palmer D.B., George A.J.T., Foxwell B.M.J.,
Ritter M.A.;
"The gp200-MR6 molecule which is functionally associated with the IL-4
receptor modulates B cell phenotype and is a novel member of the human
macrophage mannose receptor family.";
Eur. J. Immunol. 28:4071-4083(1998).
[2] {ECO:0000305}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), AND VARIANT ASN-1321.
PubMed=9553150; DOI=10.1007/s002510050381;
Kato M., Neil T.K., Clark G.J., Morris C.M., Sorg R.V., Hart D.N.J.;
"cDNA cloning of human DEC-205, a putative antigen-uptake receptor on
dendritic cells.";
Immunogenetics 47:442-450(1998).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY, AND
VARIANT ASN-1321.
PubMed=12824192; DOI=10.1074/jbc.M303112200;
Kato M., Khan S., Gonzalez N., O'Neill B.P., McDonald K.J.,
Cooper B.J., Angel N.Z., Hart D.N.J.;
"Hodgkin's lymphoma cell lines express a fusion protein encoded by
intergenically spliced mRNA for the multilectin receptor DEC-205
(CD205) and a novel C-type lectin receptor DCL-1.";
J. Biol. Chem. 278:34035-34041(2003).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[5]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-933, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
-!- FUNCTION: Acts as an endocytic receptor to direct captured
antigens from the extracellular space to a specialized antigen-
processing compartment (By similarity). Causes reduced
proliferation of B-lymphocytes. {ECO:0000250}.
-!- INTERACTION:
Q969F0:FATE1; NbExp=3; IntAct=EBI-10186753, EBI-743099;
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000250}; Single-pass type I
membrane protein {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=4;
IsoId=O60449-1; Sequence=Displayed;
Name=2; Synonyms=Fusion protein variant V34-2;
IsoId=O60449-2; Sequence=VSP_020909;
Note=Produced by intergenic splicing of LY75 and CD302.;
Name=5;
IsoId=Q8IX05-2; Sequence=External;
Name=3; Synonyms=Fusion protein variant V33-2;
IsoId=O60449-3; Sequence=VSP_020908;
Note=Produced by intergenic splicing of LY75 and CD302.;
Name=1;
IsoId=Q8IX05-1; Sequence=External;
Note=Produced by intergenic splicing of LY75 and CD302.;
-!- TISSUE SPECIFICITY: Expressed in spleen, thymus, colon and
peripheral blood lymphocytes. Detected in myeloid and B-lymphoid
cell lines. Isoform 2 and isoform 3 are expressed in malignant
Hodgkin lymphoma cells called Hodgkin and Reed-Sternberg (HRS)
cells. {ECO:0000269|PubMed:12824192, ECO:0000269|PubMed:9862343}.
-!- PTM: N-glycosylated. {ECO:0000269|PubMed:9862343}.
-!- MISCELLANEOUS: Isoform 2 and isoform 3 are produced in HRS cells
by a transcriptional control mechanism which cotranscribe an mRNA
containing LY75 and CD302 prior to generating the intergenically
spliced mRNA to produce LY75/CD302 fusion proteins.
-!- WEB RESOURCE: Name=Functional Glycomics Gateway - Glycan Binding;
Note=DEC-205;
URL="http://www.functionalglycomics.org/glycomics/GBPServlet?&operationType=view&cbpId=cbp_hum_Ctlect_250";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF064827; AAC62622.1; -; mRNA.
EMBL; AF011333; AAC17636.1; -; mRNA.
EMBL; AY184222; AAN85434.1; -; mRNA.
EMBL; AY314006; AAP79899.1; -; mRNA.
EMBL; AC009961; AAY14943.1; -; Genomic_DNA.
EMBL; AC093873; AAY24189.1; -; Genomic_DNA.
CCDS; CCDS2211.1; -. [O60449-1]
RefSeq; NP_001185688.1; NM_001198759.1. [O60449-2]
RefSeq; NP_001185689.1; NM_001198760.1. [O60449-3]
RefSeq; NP_002340.2; NM_002349.3. [O60449-1]
UniGene; Hs.153563; -.
ProteinModelPortal; O60449; -.
IntAct; O60449; 2.
STRING; 9606.ENSP00000451511; -.
CarbonylDB; O60449; -.
iPTMnet; O60449; -.
PhosphoSitePlus; O60449; -.
BioMuta; LY75; -.
PaxDb; O60449; -.
PeptideAtlas; O60449; -.
PRIDE; O60449; -.
DNASU; 4065; -.
Ensembl; ENST00000263636; ENSP00000263636; ENSG00000054219. [O60449-1]
GeneID; 100526664; -.
GeneID; 4065; -.
KEGG; hsa:100526664; -.
KEGG; hsa:4065; -.
UCSC; uc002ubc.6; human. [O60449-1]
CTD; 100526664; -.
CTD; 4065; -.
DisGeNET; 100526664; -.
DisGeNET; 4065; -.
EuPathDB; HostDB:ENSG00000054219.10; -.
GeneCards; LY75; -.
H-InvDB; HIX0024086; -.
HGNC; HGNC:6729; LY75.
HPA; CAB001450; -.
HPA; HPA049108; -.
HPA; HPA054073; -.
MIM; 604524; gene.
neXtProt; NX_O60449; -.
OpenTargets; ENSG00000054219; -.
OpenTargets; ENSG00000248672; -.
PharmGKB; PA30493; -.
eggNOG; KOG4297; Eukaryota.
eggNOG; ENOG410XPJ1; LUCA.
GeneTree; ENSGT00720000108514; -.
HOGENOM; HOG000232050; -.
HOVERGEN; HBG045579; -.
InParanoid; O60449; -.
KO; K06559; -.
OMA; WSDGTEV; -.
OrthoDB; EOG091G0CY8; -.
PhylomeDB; O60449; -.
TreeFam; TF316663; -.
GeneWiki; LY75; -.
Proteomes; UP000005640; Chromosome 2.
Bgee; ENSG00000054219; -.
CleanEx; HS_LY75; -.
Genevisible; O60449; HS.
GO; GO:0070062; C:extracellular exosome; HDA:UniProtKB.
GO; GO:0005887; C:integral component of plasma membrane; TAS:ProtInc.
GO; GO:0030246; F:carbohydrate binding; IEA:UniProtKB-KW.
GO; GO:0004872; F:receptor activity; TAS:ProtInc.
GO; GO:0004888; F:transmembrane signaling receptor activity; IBA:GO_Central.
GO; GO:0006897; P:endocytosis; IEA:UniProtKB-KW.
GO; GO:0006955; P:immune response; TAS:ProtInc.
GO; GO:0006954; P:inflammatory response; TAS:ProtInc.
CDD; cd00062; FN2; 1.
CDD; cd00161; RICIN; 1.
Gene3D; 2.10.10.10; -; 1.
Gene3D; 3.10.100.10; -; 10.
InterPro; IPR001304; C-type_lectin-like.
InterPro; IPR016186; C-type_lectin-like/link_sf.
InterPro; IPR018378; C-type_lectin_CS.
InterPro; IPR016187; CTDL_fold.
InterPro; IPR000562; FN_type2_dom.
InterPro; IPR036943; FN_type2_sf.
InterPro; IPR013806; Kringle-like.
InterPro; IPR035992; Ricin_B-like_lectins.
InterPro; IPR000772; Ricin_B_lectin.
Pfam; PF00040; fn2; 1.
Pfam; PF00059; Lectin_C; 10.
SMART; SM00034; CLECT; 10.
SMART; SM00059; FN2; 1.
SMART; SM00458; RICIN; 1.
SUPFAM; SSF50370; SSF50370; 1.
SUPFAM; SSF56436; SSF56436; 10.
SUPFAM; SSF57440; SSF57440; 1.
PROSITE; PS00615; C_TYPE_LECTIN_1; 1.
PROSITE; PS50041; C_TYPE_LECTIN_2; 10.
PROSITE; PS00023; FN2_1; 1.
PROSITE; PS51092; FN2_2; 1.
PROSITE; PS50231; RICIN_B_LECTIN; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Direct protein sequencing;
Disulfide bond; Endocytosis; Glycoprotein; Lectin; Membrane;
Phosphoprotein; Polymorphism; Receptor; Reference proteome; Repeat;
Signal; Transmembrane; Transmembrane helix.
SIGNAL 1 27 {ECO:0000269|PubMed:9862343}.
CHAIN 28 1722 Lymphocyte antigen 75.
/FTId=PRO_0000017552.
TOPO_DOM 28 1666 Extracellular. {ECO:0000255}.
TRANSMEM 1667 1691 Helical. {ECO:0000255}.
TOPO_DOM 1692 1722 Cytoplasmic. {ECO:0000255}.
DOMAIN 33 156 Ricin B-type lectin.
{ECO:0000255|PROSITE-ProRule:PRU00174}.
DOMAIN 164 211 Fibronectin type-II.
{ECO:0000255|PROSITE-ProRule:PRU00479}.
DOMAIN 225 341 C-type lectin 1. {ECO:0000255|PROSITE-
ProRule:PRU00040}.
DOMAIN 368 486 C-type lectin 2. {ECO:0000255|PROSITE-
ProRule:PRU00040}.
DOMAIN 493 625 C-type lectin 3. {ECO:0000255|PROSITE-
ProRule:PRU00040}.
DOMAIN 652 778 C-type lectin 4. {ECO:0000255|PROSITE-
ProRule:PRU00040}.
DOMAIN 818 931 C-type lectin 5. {ECO:0000255|PROSITE-
ProRule:PRU00040}.
DOMAIN 958 1091 C-type lectin 6. {ECO:0000255|PROSITE-
ProRule:PRU00040}.
DOMAIN 1110 1222 C-type lectin 7. {ECO:0000255|PROSITE-
ProRule:PRU00040}.
DOMAIN 1251 1374 C-type lectin 8. {ECO:0000255|PROSITE-
ProRule:PRU00040}.
DOMAIN 1401 1513 C-type lectin 9. {ECO:0000255|PROSITE-
ProRule:PRU00040}.
DOMAIN 1542 1661 C-type lectin 10. {ECO:0000255|PROSITE-
ProRule:PRU00040}.
MOD_RES 933 933 Phosphotyrosine.
{ECO:0000244|PubMed:18669648}.
MOD_RES 1703 1703 Phosphoserine.
{ECO:0000250|UniProtKB:Q60767}.
MOD_RES 1719 1719 Phosphoserine.
{ECO:0000250|UniProtKB:Q60767}.
CARBOHYD 135 135 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 345 345 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 377 377 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 529 529 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 843 843 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 865 865 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 934 934 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1076 1076 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1103 1103 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1225 1225 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1320 1320 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1392 1392 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1593 1593 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1626 1626 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 169 194 {ECO:0000250}.
DISULFID 183 209 {ECO:0000250}.
DISULFID 247 340 {ECO:0000250}.
DISULFID 317 332 {ECO:0000250}.
DISULFID 389 485 {ECO:0000250}.
DISULFID 462 477 {ECO:0000250}.
DISULFID 597 614 {ECO:0000250}.
DISULFID 840 930 {ECO:0000250}.
DISULFID 904 922 {ECO:0000250}.
DISULFID 1060 1080 {ECO:0000250}.
DISULFID 1197 1211 {ECO:0000250}.
DISULFID 1488 1502 {ECO:0000250}.
DISULFID 1635 1650 {ECO:0000250}.
VAR_SEQ 1608 1722 DQSWSWLDGSEVTFVKWENKSKSGVGRCSMLIASNETWKKV
ECEHGFGRVVCKVPLGPDYTAIAIIVATLSILVLMGGLIWF
LFQRHRLHLAGFSSVRYAQGVNEDEIMLPSFHD -> DCPS
STWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIH
NEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNS
NMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVE
GTLCKTAIPYKRKYLSDNHILISALVIASTVILTVLGAIIW
FLYKKHSDSRFTTVFSTAPQSPYNEDCVLVVGEENEYPVQF
D (in isoform 3).
{ECO:0000303|PubMed:12824192}.
/FTId=VSP_020908.
VAR_SEQ 1664 1722 GPDYTAIAIIVATLSILVLMGGLIWFLFQRHRLHLAGFSSV
RYAQGVNEDEIMLPSFHD -> DCPSSTWIQFQDSCYIFLQ
EAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQ
WKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDED
LVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRKYL
SDNHILISALVIASTVILTVLGAIIWFLYKKHSDSRFTTVF
STAPQSPYNEDCVLVVGEENEYPVQFD (in isoform
2). {ECO:0000303|PubMed:12824192}.
/FTId=VSP_020909.
VARIANT 20 20 W -> R (in dbSNP:rs35284483).
/FTId=VAR_056156.
VARIANT 268 268 E -> D (in dbSNP:rs2271381).
{ECO:0000269|PubMed:9862343}.
/FTId=VAR_027824.
VARIANT 486 486 K -> M (in dbSNP:rs2729709).
/FTId=VAR_027825.
VARIANT 666 666 V -> A (in dbSNP:rs34020639).
/FTId=VAR_056157.
VARIANT 692 692 D -> N (in dbSNP:rs1397706).
/FTId=VAR_024522.
VARIANT 807 807 D -> E (in dbSNP:rs3951216).
{ECO:0000269|PubMed:9862343}.
/FTId=VAR_027826.
VARIANT 884 884 D -> A (in dbSNP:rs3815875).
/FTId=VAR_027827.
VARIANT 1202 1202 T -> S (in dbSNP:rs2303549).
/FTId=VAR_027828.
VARIANT 1321 1321 K -> N (in dbSNP:rs12692566).
{ECO:0000269|PubMed:12824192,
ECO:0000269|PubMed:9553150}.
/FTId=VAR_027829.
VARIANT 1347 1347 K -> R (in dbSNP:rs17827158).
/FTId=VAR_027830.
VARIANT 1391 1391 Y -> H (in dbSNP:rs2059696).
/FTId=VAR_027831.
VARIANT 1393 1393 T -> I (in dbSNP:rs35941588).
/FTId=VAR_056158.
SEQUENCE 1722 AA; 198311 MW; 4BC17EC646BF016F CRC64;
MRTGWATPRR PAGLLMLLFW FFDLAEPSGR AANDPFTIVH GNTGKCIKPV YGWIVADDCD
ETEDKLWKWV SQHRLFHLHS QKCLGLDITK SVNELRMFSC DSSAMLWWKC EHHSLYGAAR
YRLALKDGHG TAISNASDVW KKGGSEESLC DQPYHEIYTR DGNSYGRPCE FPFLIDGTWH
HDCILDEDHS GPWCATTLNY EYDRKWGICL KPENGCEDNW EKNEQFGSCY QFNTQTALSW
KEAYVSCQNQ GADLLSINSA AELTYLKEKE GIAKIFWIGL NQLYSARGWE WSDHKPLNFL
NWDPDRPSAP TIGGSSCARM DAESGLWQSF SCEAQLPYVC RKPLNNTVEL TDVWTYSDTR
CDAGWLPNNG FCYLLVNESN SWDKAHAKCK AFSSDLISIH SLADVEVVVT KLHNEDIKEE
VWIGLKNINI PTLFQWSDGT EVTLTYWDEN EPNVPYNKTP NCVSYLGELG QWKVQSCEEK
LKYVCKRKGE KLNDASSDKM CPPDEGWKRH GETCYKIYED EVPFGTNCNL TITSRFEQEY
LNDLMKKYDK SLRKYFWTGL RDVDSCGEYN WATVGGRRRA VTFSNWNFLE PASPGGCVAM
STGKSVGKWE VKDCRSFKAL SICKKMSGPL GPEEASPKPD DPCPEGWQSF PASLSCYKVF
HAERIVRKRN WEEAERFCQA LGAHLSSFSH VDEIKEFLHF LTDQFSGQHW LWIGLNKRSP
DLQGSWQWSD RTPVSTIIMP NEFQQDYDIR DCAAVKVFHR PWRRGWHFYD DREFIYLRPF
ACDTKLEWVC QIPKGRTPKT PDWYNPDRAG IHGPPLIIEG SEYWFVADLH LNYEEAVLYC
ASNHSFLATI TSFVGLKAIK NKIANISGDG QKWWIRISEW PIDDHFTYSR YPWHRFPVTF
GEECLYMSAK TWLIDLGKPT DCSTKLPFIC EKYNVSSLEK YSPDSAAKVQ CSEQWIPFQN
KCFLKIKPVS LTFSQASDTC HSYGGTLPSV LSQIEQDFIT SLLPDMEATL WIGLRWTAYE
KINKWTDNRE LTYSNFHPLL VSGRLRIPEN FFEEESRYHC ALILNLQKSP FTGTWNFTSC
SERHFVSLCQ KYSEVKSRQT LQNASETVKY LNNLYKIIPK TLTWHSAKRE CLKSNMQLVS
ITDPYQQAFL SVQALLHNSS LWIGLFSQDD ELNFGWSDGK RLHFSRWAET NGQLEDCVVL
DTDGFWKTVD CNDNQPGAIC YYSGNETEKE VKPVDSVKCP SPVLNTPWIP FQNCCYNFII
TKNRHMATTQ DEVHTKCQKL NPKSHILSIR DEKENNFVLE QLLYFNYMAS WVMLGITYRN
KSLMWFDKTP LSYTHWRAGR PTIKNEKFLA GLSTDGFWDI QTFKVIEEAV YFHQHSILAC
KIEMVDYKEE YNTTLPQFMP YEDGIYSVIQ KKVTWYEALN MCSQSGGHLA SVHNQNGQLF
LEDIVKRDGF PLWVGLSSHD GSESSFEWSD GSTFDYIPWK GQTSPGNCVL LDPKGTWKHE
KCNSVKDGAI CYKPTKSKKL SRLTYSSRCP AAKENGSRWI QYKGHCYKSD QALHSFSEAK
KLCSKHDHSA TIVSIKDEDE NKFVSRLMRE NNNITMRVWL GLSQHSVDQS WSWLDGSEVT
FVKWENKSKS GVGRCSMLIA SNETWKKVEC EHGFGRVVCK VPLGPDYTAI AIIVATLSIL
VLMGGLIWFL FQRHRLHLAG FSSVRYAQGV NEDEIMLPSF HD


Related products :

Catalog number Product name Quantity
EIAAB07698 CLEC11A,CLECSF3,C-type lectin domain family 11 member A,C-type lectin superfamily member 3,Homo sapiens,Human,LSLCL,Lymphocyte secreted C-type lectin,p47,SCGF,Stem cell growth factor
EIAAB07724 BDCA2,BDCA-2,Blood dendritic cell antigen 2,CLEC4C,CLECSF11,CLECSF7,C-type lectin domain family 4 member C,C-type lectin superfamily member 7,Dendritic lectin,DLEC,HECL,Homo sapiens,Human,UNQ9361_PRO3
EIAAB06310 CD302,CD302 antigen,CLEC13A,C-type lectin BIMLEC,C-type lectin domain family 13 member A,DCL1,Homo sapiens,Human,KIAA0022,Type I transmembrane C-type lectin receptor DCL-1
EIAAB07697 Clec11a,C-type lectin domain family 11 member A,Lymphocyte secreted C-type lectin,Mouse,Mus musculus,Scgf,Stem cell growth factor
EIAAB07696 Clec11a,C-type lectin domain family 11 member A,Lymphocyte secreted C-type lectin,Rat,Rattus norvegicus,Scgf,Stem cell growth factor
EIAAB06311 Cd302,CD302 antigen,Clec13a,C-type lectin domain family 13 member A,Mouse,Mus musculus,Type I transmembrane C-type lectin receptor DCL-1
EIAAB07743 CLEC6A,CLECSF10,C-type lectin domain family 6 member A,C-type lectin superfamily member 10,DC-associated C-type lectin 2,DECTIN2,Dectin-2,Dendritic cell-associated C-type lectin 2,Homo sapiens,Human
EIAAB07742 Clec4n,Clec6a,Clecsf10,C-type lectin domain family 6 member A,C-type lectin superfamily member 10,DC-associated C-type lectin 2,Dectin2,Dectin-2,Dendritic cell-associated C-type lectin 2,Mouse,Mus mus
EIAAB07706 CLEC2A,C-type lectin domain family 2 member A,Homo sapiens,Human,KACL,KACL,Keratinocyte-associated C-type lectin,PILAR,Proliferation-induced lymphocyte-associated receptor,UNQ5792_PRO19597
EIAAB07668 CLEC12B,C-type lectin domain family 12 member B,Homo sapiens,Human,Macrophage antigen H,UNQ5782_PRO16089
EIAAB07746 Beta-glucan receptor,Bgr,Clec7a,Clecsf12,C-type lectin domain family 7 member A,C-type lectin superfamily member 12,DC-associated C-type lectin 1,Dectin1,Dectin-1,Dendritic cell-associated C-type lect
EIAAB07747 Beta-glucan receptor,BGR,CLEC7A,CLECSF12,C-type lectin domain family 7 member A,C-type lectin superfamily member 12,DC-associated C-type lectin 1,DECTIN1,Dectin-1,Dendritic cell-associated C-type lect
EIAAB07721 CLEC4A,CLECSF6,C-type lectin DDB27,C-type lectin domain family 4 member A,C-type lectin superfamily member 6,DCIR,Dendritic cell immunoreceptor,HDCGC13P,Homo sapiens,Human,Lectin-like immunoreceptor,L
EIAAB07730 CLEC4E,CLECSF9,C-type lectin domain family 4 member E,C-type lectin superfamily member 9,Homo sapiens,Human,Macrophage-inducible C-type lectin,MINCLE,UNQ218_PRO244
EIAAB07732 Clec4f,Clecsf13,C-type lectin 13,C-type lectin domain family 4 member F,C-type lectin superfamily member 13,Kclr,Kupffer cell receptor,Mouse,Mus musculus
EIAAB07720 Cartilage-derived C-type lectin,CLEC3A,CLECSF1,C-type lectin domain family 3 member A,C-type lectin superfamily member 1,Homo sapiens,Human,UNQ700_PRO1345
EIAAB07733 Clec4f,Clecsf13,C-type lectin 13,C-type lectin domain family 4 member F,C-type lectin superfamily member 13,Kclr,Kupffer cell receptor,Rat,Rattus norvegicus
EIAAB07719 Cartilage-derived C-type lectin,Clec3a,Clecsf1,C-type lectin domain family 3 member A,C-type lectin superfamily member 1,Gm796,Mouse,Mus musculus
EIAAB07726 CLEC4D,CLEC-6,CLECSF8,C-type lectin domain family 4 member D,C-type lectin superfamily member 8,C-type lectin-like receptor 6,Homo sapiens,Human,MCL
EIAAB07728 Clec4e,Clecsf9,C-type lectin domain family 4 member E,C-type lectin superfamily member 9,Macrophage-inducible C-type lectin,Mincle,Rat,Rattus norvegicus
EIAAB07729 Clec4e,Clecsf9,C-type lectin domain family 4 member E,C-type lectin superfamily member 9,Macrophage-inducible C-type lectin,Mincle,Mouse,Mus musculus
EIAAB07727 Clec4d,Clecsf8,C-type lectin domain family 4 member D,C-type lectin superfamily member 8,Macrophage-restricted C-type lectin,Mcl,Mouse,Mus musculus
EIAAB07718 Bos taurus,Bovine,Cartilage-derived C-type lectin,CLEC3A,CLECSF1,C-type lectin domain family 3 member A,C-type lectin superfamily member 1
EIAAB07707 Activation-induced C-type lectin,AICL,CLEC2B,CLECSF2,C-type lectin domain family 2 member B,C-type lectin superfamily member 2,Homo sapiens,Human,IFN-alpha-2b-inducing-related protein 1,IFNRG1
EIAAB07731 CLEC4F,CLECSF13,C-type lectin 13,C-type lectin domain family 4 member F,C-type lectin superfamily member 13,Homo sapiens,Human


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur