Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

MHC class I polypeptide-related sequence A (MIC-A)

 MICA_HUMAN              Reviewed;         383 AA.
Q29983; A8KQR0; A9LRW5; A9QVE0; B1VJF1; O60917; O60918; O60919;
O60920; O60933; O77956; O78150; O78151; O78152; O78153; O97987;
O97988; O97989; O97990; O97991; O97992; O97993; O97994; O97995;
O98234; O98235; O98236; O98237; O98238; P79506; P79507; P79508;
P79509; P79510; P79511; P79512; P79513; P79514; P79515; P79516;
P79517; P79518; P79519; P79520; P79521; Q5C9P8; Q5XM81; Q70I48;
Q70I49; Q7JFH9; Q7JFI0; Q7JFI1; Q7JFI2; Q7YQ98; Q861I1; Q95464;
Q95HA2; Q95HD6; Q95HN4; Q95HN5; Q95HN6; Q95IB2; Q95IY7; Q99692;
Q9BCR3; Q9BCR4; Q9BCR5; Q9BCR6; Q9BCR7; Q9BCR8; Q9BCR9; Q9BCS0;
Q9BCS1; Q9BCS2; Q9BCS3; Q9BCS4; Q9BD20; Q9GIZ1; Q9GIZ2; Q9GIZ3;
Q9GIZ4; Q9GIZ5; Q9GIZ6; Q9GJ01; Q9GJ02; Q9GJ03; Q9GJ04; Q9GJ05;
Q9GJ06; Q9GJ07; Q9GJ08; Q9GJ09; Q9MY21; Q9TQ86; Q9TQ87; Q9TQ88;
Q9TQ89; Q9TQ92; Q9TQ93; Q9TQ94; Q9TQ95; Q9TQ96; Q9TQ97; Q9TQ98;
Q9TQ99; Q9TQA0; Q9TQA1; Q9TQA2; Q9TQA3; Q9TQA4; Q9TQI9; Q9TQJ0;
Q9TQJ1; Q9TQJ9; Q9TQK0; Q9TQK1; Q9TQK2; Q9TQK8; Q9TQK9; Q9TQL0;
Q9TQL1; Q9TQL2; Q9TQL3; Q9TQL4; Q9UE04; Q9UE05; Q9UE06; Q9UE11;
20-MAY-2008, integrated into UniProtKB/Swiss-Prot.
01-NOV-1996, sequence version 1.
27-SEP-2017, entry version 149.
RecName: Full=MHC class I polypeptide-related sequence A;
Short=MIC-A;
Flags: Precursor;
Name=MICA {ECO:0000312|EMBL:CAI41907.1};
Synonyms=PERB11.1 {ECO:0000303|PubMed:8613147};
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1] {ECO:0000305, ECO:0000312|EMBL:AAA21718.1}
NUCLEOTIDE SEQUENCE [MRNA] (ALLELE MICA*001).
PubMed=8022771; DOI=10.1073/pnas.91.14.6259;
Bahram S., Bresnahan M., Geraghty D.E., Spies T.;
"A second lineage of mammalian major histocompatibility complex class
I genes.";
Proc. Natl. Acad. Sci. U.S.A. 91:6259-6263(1994).
[2] {ECO:0000305, ECO:0000312|EMBL:CAA63427.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ALLELE MICA*004).
PubMed=8613147; DOI=10.1007/BF02602661;
Bahram S., Mizuki N., Inoko H., Spies T.;
"Nucleotide sequence of the human MHC class I MICA gene.";
Immunogenetics 44:80-81(1996).
[3] {ECO:0000312|EMBL:CAI41907.1}
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ALLELES MICA*001 AND
MICA*004).
PubMed=14574404; DOI=10.1038/nature02055;
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L.,
Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E.,
Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R.,
Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S.,
Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J.,
Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P.,
Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y.,
Burford D.C., Burrill W., Burton J., Carder C., Carter N.P.,
Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V.,
Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J.,
Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E.,
Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A.,
Frankland J., French L., Garner P., Garnett J., Ghori M.J.,
Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M.,
Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S.,
Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R.,
Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E.,
Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A.,
Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C.,
Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M.,
Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M.,
Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K.,
McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T.,
Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R.,
Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W.,
Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M.,
Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L.,
Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J.,
Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B.,
Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L.,
Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W.,
Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A.,
Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.;
"The DNA sequence and analysis of human chromosome 6.";
Nature 425:805-811(2003).
[4] {ECO:0000305, ECO:0000312|EMBL:AAH16929.1}
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ALLELE MICA*018), AND
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 70-248 (ISOFORM 2).
TISSUE=Bone, and Kidney {ECO:0000312|EMBL:AAH16929.1};
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5] {ECO:0000305}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 23-150 (ALLELES MICA*001;
MICA*008 AND MICA*010).
PubMed=7927538; DOI=10.1007/BF01246675;
Leelayuwat C., Townend D.C., Degli-Esposti M.A., Abraham L.J.,
Dawkins R.L.;
"A new polymorphic and multicopy MHC gene family related to
nonmammalian class I.";
Immunogenetics 40:339-351(1994).
[6] {ECO:0000305, ECO:0000312|EMBL:AAB41069.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 24-297 (ALLELES MICA*001;
MICA*002; MICA*004; MICA*005; MICA*006; MICA*007; MICA*008; MICA*009;
MICA*010; MICA*011; MICA*012; MICA*013; MICA*014; MICA*015 AND
MICA*016).
PubMed=8781120; DOI=10.1007/BF02602779;
Fodil N., Laloux L., Wanner V., Pellet P., Hauptmann G., Mizuki N.,
Inoko H., Spies T., Theodorou I., Bahram S.;
"Allelic repertoire of the human MHC class I MICA gene.";
Immunogenetics 44:351-357(1996).
[7] {ECO:0000305, ECO:0000312|EMBL:CAA76395.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 24-297 (ALLELES MICA*007;
MICA*008; MICA*009; MICA*010; MICA*012; MICA*016; MICA*017; MICA*018;
MICA*022; MICA*024; MICA*025; MICA*028 AND MICA*029).
PubMed=10331160; DOI=10.1046/j.1365-2370.1999.00094.x;
Yao Z., Volgger A., Helmberg W., Keller E., Fan L.A.,
Chandanayingyong D., Albert E.D.;
"Definition of new alleles of MIC-A using sequencing-based typing.";
Eur. J. Immunogenet. 26:225-232(1999).
[8] {ECO:0000305, ECO:0000312|EMBL:AAD27009.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 24-297 (ALLELES MICA*009;
MICA*017; MICA*018 AND MICA*019).
PubMed=10380703; DOI=10.1007/s002510050536;
Fodil N., Pellet P., Laloux L., Hauptmann G., Theodorou I., Bahram S.;
"MICA haplotypic diversity.";
Immunogenetics 49:557-560(1999).
[9] {ECO:0000305, ECO:0000312|EMBL:BAA29034.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 24-297 (ALLELE MICA*019).
PubMed=10369920; DOI=10.1007/s002510050658;
Komatsu-Wakui M., Tokunaga K., Ishikawa Y., Kashiwase K., Moriyama S.,
Tsuchiya N., Ando H., Shiina T., Geraghty D.E., Inoko H., Juji T.;
"MIC-A polymorphism in Japanese and a MIC-A-MIC-B null haplotype.";
Immunogenetics 49:620-628(1999).
[10] {ECO:0000305, ECO:0000312|EMBL:CAD91415.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 24-297 (ALLELE MICA*051).
TISSUE=Blood {ECO:0000312|EMBL:CAD91415.1};
PubMed=15104678; DOI=10.1111/j.0001-2815.2004.00195.x;
Quiroga I., Sweeney D., Sutton P.M., Chapple S.D., Souto-Grando J.P.,
Barnardo M.C.N.M., Fuggle S.V.;
"Identification of a novel MICA allele: MICA*051.";
Tissue Antigens 63:466-469(2004).
[11] {ECO:0000305, ECO:0000312|EMBL:AAD01476.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-383 (ALLELES MICA*008;
MICA*023 AND MICA*028), AND NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF
25-341 (ALLELES MICA*001; MICA*002; MICA*004; MICA*006; MICA*007;
MICA*009; MICA*010; MICA*011; MICA*016; MICA*018; MICA*019; MICA*022;
MICA*024; MICA*025; MICA*026; MICA*027; MICA*031; MICA*032; MICA*033;
MICA*034; MICA*035; MICA*036; MICA*037; MICA*038; MICA*039 AND
MICA*040).
PubMed=10380704; DOI=10.1007/s002510050537;
Visser C.J.T., Tilanus M.G.J., Tatari Z., van der Zwan A.-W.,
Bakker R., Rozemuller E.H., Schaeffer V., Tamouza R., Charron D.;
"Sequencing-based typing of MICA reveals 33 alleles: a study on
linkage with classical HLA genes.";
Immunogenetics 49:561-566(1999).
[12] {ECO:0000305, ECO:0000312|EMBL:AAK19623.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-383 (ALLELES MICA*001;
MICA*002; MICA*006; MICA*008; MICA*009; MICA*010; MICA*011; MICA*012;
MICA*015; MICA*016; MICA*017; MICA*018; MICA*019; MICA*048 AND
MICA*049).
PubMed=11556982; DOI=10.1034/j.1399-0039.2001.057006520.x;
Obuchi N., Takahashi M., Nouchi T., Satoh M., Arimura T., Ueda K.,
Akai J., Ota M., Naruse T., Inoko H., Numano F., Kimura A.;
"Identification of MICA alleles with a long Leu-repeat in the
transmembrane region and no cytoplasmic tail due to a frameshift-
deletion in exon 4.";
Tissue Antigens 57:520-535(2001).
[13] {ECO:0000305, ECO:0000312|EMBL:CAC27561.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-371 (ALLELES MICA*008;
MICA*017; MICA*018; MICA*019; MICA*027; MICA*029; MICA*033; MICA*041;
MICA*043; MICA*045 AND MICA*046).
PubMed=11841487; DOI=10.1046/j.0960-7420.2001.00275.x;
Perez-Rodriguez M., Arguello J.R., Fischer G., Corell A., Cox S.T.,
Robinson J., Hossain E., McWhinnie A., Travers P.J., Marsh S.G.E.,
Madrigal J.A.;
"Further polymorphism of the MICA gene.";
Eur. J. Immunogenet. 29:35-46(2002).
[14] {ECO:0000305, ECO:0000312|EMBL:AAV39504.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-371 (ALLELE MICA*008).
Kaur G., Shiina T., Hashimoto N., Kumar N., Inoko H., Mehra N.K.;
"MIC-A sequence in AH8.2.";
Submitted (APR-2004) to the EMBL/GenBank/DDBJ databases.
[15] {ECO:0000305, ECO:0000312|EMBL:CAB71317.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-341 (ALLELE MICA*020).
PubMed=10746789; DOI=10.1034/j.1399-0039.2000.550209.x;
Perez-Rodriguez M., Corell A., Fischer G., Arguello R., Cox S.T.,
McWhinnie A., Marsh S.G.E., Madrigal A.;
"A new MICA allele with ten alanine residues in the exon 5
microsatellite.";
Tissue Antigens 55:162-165(2000).
[16] {ECO:0000305, ECO:0000312|EMBL:CAC88121.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-341 (ALLELE MICA*047).
PubMed=12074712; DOI=10.1034/j.1399-0039.2002.590306.x;
Perez-Rodriguez M., Raimondi E., Marsh S.G.E., Madrigal J.A.;
"Identification of a new MICA allele, MICA*047.";
Tissue Antigens 59:216-218(2002).
[17] {ECO:0000305, ECO:0000312|EMBL:CAE45582.2}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-341 (ALLELES MICA*007;
MICA*018 AND MICA*053).
PubMed=16634869; DOI=10.1111/j.1399-0039.2006.00574.x;
Quiroga I., Sweeney D., Sutton P.M., Ahmad T., Walton R.,
Barnardo M.C.N.M., Fuggle S.V.;
"The identification of three novel MICA alleles by sequence-based
typing.";
Tissue Antigens 67:321-325(2006).
[18] {ECO:0000305, ECO:0000312|EMBL:AAV39504.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-341 (ALLELE MICA*052).
Mas V., Amezaga N., Arostegui J.I., Masso M., Plaza S., Rius F.,
Ercilla G., Vives J., Yague J.;
"Description of a new MICA allele.";
Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases.
[19] {ECO:0000305, ECO:0000312|EMBL:AAV39504.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-341 (ALLELE MICA*054).
TISSUE=Blood {ECO:0000312|EMBL:CAP12057.1};
Cox S.T.;
"Description of a novel MICA allele, MICA*010v, discovered by
sequencing based typing.";
Submitted (OCT-2007) to the EMBL/GenBank/DDBJ databases.
[20] {ECO:0000305, ECO:0000312|EMBL:AAV39504.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-341 (ALLELE MICA*055).
Glas J., Maier K., Wetzke M., Henninger M., Euba A., Weiss E.H.,
Folwaczny M.;
"MICA*TM A8: a new allele with eight GCT repeats in the exon 5
microsatellite.";
Submitted (OCT-2007) to the EMBL/GenBank/DDBJ databases.
[21] {ECO:0000305, ECO:0000312|EMBL:AAV39504.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-341 (ALLELE MICA*056).
Cox S.T.;
"Sequence of new MICA allele, similar to MICA*019.";
Submitted (FEB-2008) to the EMBL/GenBank/DDBJ databases.
[22] {ECO:0000305, ECO:0000312|EMBL:AAC28944.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-297 (ALLELES MICA*009;
MICA*017; MICA*018; MICA*019 AND MICA*030).
PubMed=10369917; DOI=10.1007/s002510050655;
Petersdorf E.W., Shuler K.B., Longton G.M., Spies T., Hansen J.A.;
"Population study of allelic diversity in the human MHC class I-
related MIC-A gene.";
Immunogenetics 49:605-612(1999).
[23] {ECO:0000305, ECO:0000312|EMBL:AAV39504.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-297 (ALLELES MICA*008;
MICA*012; MICA*041; MICA*042; MICA*043; MICA*044 AND MICA*045).
Hirose T., Mitsuishi Y., Young C.;
"New alleles of human non-classical class I MICA gene.";
Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases.
[24] {ECO:0000305, ECO:0000312|EMBL:AAV39504.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-283 (ALLELE MICA*019).
Yan L., Zhu F.;
"Identification of a novel MICA allele by SBT.";
Submitted (NOV-2007) to the EMBL/GenBank/DDBJ databases.
[25] {ECO:0000305, ECO:0000312|EMBL:AAM34484.1}
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 299-341 (ALLELE MICA*050).
PubMed=12542746; DOI=10.1034/j.1399-0039.2002.600608.x;
Rueda B., Pascual M., Lopez-Nevot M.A., Gonzalez E., Martin J.;
"A new allele within the transmembrane region of the human MICA gene
with seven GCT repeats.";
Tissue Antigens 60:526-528(2002).
[26] {ECO:0000305}
SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION, AND
GLYCOSYLATION.
PubMed=8901601; DOI=10.1073/pnas.93.22.12445;
Groh V., Bahram S., Bauer S., Herman A., Beauchamp M., Spies T.;
"Cell stress-regulated human major histocompatibility complex class I
gene expressed in gastrointestinal epithelium.";
Proc. Natl. Acad. Sci. U.S.A. 93:12445-12450(1996).
[27] {ECO:0000305}
SUBUNIT, AND TISSUE SPECIFICITY.
PubMed=9396860; DOI=10.1007/s002510050339;
Zwirner N.W., Fernandez-Vina M.A., Stastny P.;
"MICA, a new polymorphic HLA-related antigen, is expressed mainly by
keratinocytes, endothelial cells, and monocytes.";
Immunogenetics 47:139-148(1998).
[28] {ECO:0000305}
FUNCTION, AND INDUCTION.
PubMed=9497295; DOI=10.1126/science.279.5357.1737;
Groh V., Steinle A., Bauer S., Spies T.;
"Recognition of stress-induced MHC molecules by intestinal epithelial
gammadelta T cells.";
Science 279:1737-1740(1998).
[29] {ECO:0000305}
INVOLVEMENT IN PSORIATIC ARTHRITIS SUSCEPTIBILITY.
PubMed=10323458;
DOI=10.1002/1529-0131(199905)42:5<1010::AID-ANR21>3.0.CO;2-H;
Gonzalez S., Martinez-Borra J., Torre-Alonso J.C., Gonzalez-Roces S.,
Sanchez del Rio J., Rodriguez Perez A., Brautbar C., Lopez-Larrea C.;
"The MICA-A9 triplet repeat polymorphism in the transmembrane region
confers additional susceptibility to the development of psoriatic
arthritis and is independent of the association of Cw*0602 in
psoriasis.";
Arthritis Rheum. 42:1010-1016(1999).
[30] {ECO:0000305}
SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
PubMed=10363723; DOI=10.1016/S0198-8859(98)00128-1;
Zwirner N.W., Dole K., Stastny P.;
"Differential surface expression of MICA by endothelial cells,
fibroblasts, keratinocytes, and monocytes.";
Hum. Immunol. 60:323-330(1999).
[31] {ECO:0000305}
TISSUE SPECIFICITY.
PubMed=10359807; DOI=10.1073/pnas.96.12.6879;
Groh V., Rhinehart R., Secrist H., Bauer S., Grabstein K.H., Spies T.;
"Broad tumor-associated expression and recognition by tumor-derived
gamma delta T cells of MICA and MICB.";
Proc. Natl. Acad. Sci. U.S.A. 96:6879-6884(1999).
[32] {ECO:0000305}
FUNCTION, AND INTERACTION WITH KLRK1.
PubMed=10426993; DOI=10.1126/science.285.5428.727;
Bauer S., Groh V., Wu J., Steinle A., Phillips J.H., Lanier L.L.,
Spies T.;
"Activation of NK cells and T cells by NKG2D, a receptor for stress-
inducible MICA.";
Science 285:727-729(1999).
[33] {ECO:0000305}
SUBUNIT.
PubMed=10426994; DOI=10.1126/science.285.5428.730;
Wu J., Song Y., Bakker A.B.H., Bauer S., Spies T., Lanier L.L.,
Phillips J.H.;
"An activating immunoreceptor complex formed by NKG2D and DAP10.";
Science 285:730-732(1999).
[34] {ECO:0000305}
TISSUE SPECIFICITY, AND ASSOCIATION WITH PSORIASIS.
PubMed=10691930; DOI=10.1046/j.1365-2249.2000.01140.x;
Tay G.K., Hui J., Gaudieri S., Schmitt-Egenolf M., Martinez O.P.,
Leelayuwat C., Williamson J.F., Eiermann T.H., Dawkins R.L.;
"PERB11 (MIC): a polymorphic MHC gene is expressed in skin and single
nucleotide polymorphisms are associated with psoriasis.";
Clin. Exp. Immunol. 119:553-558(2000).
[35] {ECO:0000305}
IDENTIFICATION AS AN ALLOANTIGEN.
PubMed=11053635; DOI=10.1016/S0198-8859(00)00162-2;
Zwirner N.W., Marcos C.Y., Mirbaha F., Zou Y., Stastny P.;
"Identification of MICA as a new polymorphic alloantigen recognized by
antibodies in sera of organ transplant recipients.";
Hum. Immunol. 61:917-924(2000).
[36]
FUNCTION AS A LIGAND FOR KLRK1.
PubMed=11777960; DOI=10.4049/jimmunol.168.2.671;
Sutherland C.L., Chalupny N.J., Schooley K., VandenBos T., Kubin M.,
Cosman D.;
"UL16-binding proteins, novel MHC class I-related proteins, bind to
NKG2D and activate multiple signaling pathways in primary NK cells.";
J. Immunol. 168:671-679(2002).
[37]
INTERACTION WITH HHV-5 PROTEIN UL142.
PubMed=19793804; DOI=10.1128/JVI.01175-09;
Ashiru O., Bennett N.J., Boyle L.H., Thomas M., Trowsdale J.,
Wills M.R.;
"NKG2D ligand MICA is retained in the cis-Golgi apparatus by human
cytomegalovirus protein UL142.";
J. Virol. 83:12345-12354(2009).
[38] {ECO:0000305}
VARIANT PRO-29.
PubMed=10752636; DOI=10.1007/s002510050039;
Li Z., Groh V., Strong R.K., Spies T.;
"A single amino acid substitution causes loss of expression of a MICA
allele.";
Immunogenetics 51:246-248(2000).
[39] {ECO:0000305}
INDUCTION.
PubMed=11485740; DOI=10.1016/S1074-7613(01)00168-6;
Das H., Groh V., Kuijl C., Sugita M., Morita C.T., Spies T.,
Bukowski J.F.;
"MICA engagement by human Vgamma2Vdelta2 T cells enhances their
antigen-dependent effector function.";
Immunity 15:83-93(2001).
[40] {ECO:0000305}
FUNCTION, INTERACTION WITH KLRK1, AND EFFECT OF VARIANT VAL-152 ON
BINDING TO KLRK1.
PubMed=11491531; DOI=10.1007/s002510100325;
Steinle A., Li P., Morris D.L., Groh V., Lanier L.L., Strong R.K.,
Spies T.;
"Interactions of human NKG2D with its ligands MICA, MICB, and homologs
of the mouse RAE-1 protein family.";
Immunogenetics 53:279-287(2001).
[41] {ECO:0000305}
FUNCTION AS A LIGAND FOR KLRK1, AND INDUCTION.
PubMed=11224526; DOI=10.1038/85321;
Groh V., Rhinehart R., Randolph-Habecker J., Topp M.S., Riddell S.R.,
Spies T.;
"Costimulation of CD8alphabeta T cells by NKG2D via engagement by MIC
induced on virus-infected cells.";
Nat. Immunol. 2:255-260(2001).
[42] {ECO:0000305}
ALTERNATIVE SPLICING (ISOFORMS 1 AND 2).
PubMed=12466900; DOI=10.1007/s00251-002-0496-y;
Zou Y., Stastny P.;
"Alternatively spliced forms of MICA and MICB lacking exon 3 in a
human cell line and evidence of presence of similar RNA in human
peripheral blood mononuclear cells.";
Immunogenetics 54:671-674(2002).
[43] {ECO:0000305}
PROTEOLYTIC CLEAVAGE ON TUMOR CELLS.
PubMed=12370336; DOI=10.4049/jimmunol.169.8.4098;
Salih H.R., Rammensee H.-G., Steinle A.;
"Down-regulation of MICA on human tumors by proteolytic shedding.";
J. Immunol. 169:4098-4102(2002).
[44] {ECO:0000305}
PROTEOLYTIC CLEAVAGE ON TUMOR CELLS.
PubMed=12384702; DOI=10.1038/nature01112;
Groh V., Wu J., Yee C., Spies T.;
"Tumour-derived soluble MIC ligands impair expression of NKG2D and T-
cell activation.";
Nature 419:734-738(2002).
[45] {ECO:0000305}
INDUCTION.
PubMed=11830641; DOI=10.1073/pnas.032668099;
Tieng V., Le Bouguenec C., du Merle L., Bertheau P., Desreumaux P.,
Janin A., Charron D., Toubert A.;
"Binding of Escherichia coli adhesin AfaE to CD55 triggers cell-
surface expression of the MHC class I-related molecule MICA.";
Proc. Natl. Acad. Sci. U.S.A. 99:2977-2982(2002).
[46] {ECO:0000305}
TISSUE SPECIFICITY.
PubMed=12902493; DOI=10.4049/jimmunol.171.4.1909;
Hue S., Monteiro R.C., Berrih-Aknin S., Caillat-Zucman S.;
"Potential role of NKG2D/MHC class I-related chain A interaction in
intrathymic maturation of single-positive CD8 T cells.";
J. Immunol. 171:1909-1917(2003).
[47] {ECO:0000305}
INDUCTION.
PubMed=15995699; DOI=10.1038/nature03884;
Gasser S., Orsulic S., Brown E.J., Raulet D.H.;
"The DNA damage pathway regulates innate immune system ligands of the
NKG2D receptor.";
Nature 436:1186-1190(2005).
[48] {ECO:0000305}
INDUCTION.
PubMed=16750166; DOI=10.1016/j.bbrc.2006.05.092;
Chalupny N.J., Rein-Weston A., Dosch S., Cosman D.;
"Down-regulation of the NKG2D ligand MICA by the human cytomegalovirus
glycoprotein UL142.";
Biochem. Biophys. Res. Commun. 346:175-181(2006).
[49] {ECO:0000305}
INTERACTION WITH PDIA6.
PubMed=17495932; DOI=10.1038/nature05768;
Kaiser B.K., Yim D., Chow I.-T., Gonzalez S., Dai Z., Mann H.H.,
Strong R.K., Groh V., Spies T.;
"Disulphide-isomerase-enabled shedding of tumour-associated NKG2D
ligands.";
Nature 447:482-486(2007).
[50] {ECO:0000305}
TISSUE SPECIFICITY.
PubMed=17565371; DOI=10.1371/journal.pone.0000518;
Schrambach S., Ardizzone M., Leymarie V., Sibilia J., Bahram S.;
"In vivo expression pattern of MICA and MICB and its relevance to
auto-immunity and cancer.";
PLoS ONE 2:E518-E518(2007).
[51] {ECO:0000305}
SUBCELLULAR LOCATION, AND INDUCTION.
PubMed=18287244; DOI=10.1128/JVI.02251-07;
McSharry B.P., Burgert H.-G., Owen D.P., Stanton R.J., Prod'homme V.,
Sester M., Koebernick K., Groh V., Spies T., Cox S.T., Little A.-M.,
Wang E.C.Y., Tomasec P., Wilkinson G.W.;
"Adenovirus E3/19K promotes evasion of NK cell recognition by
intracellular sequestration of the NKG2D ligands MICA and MICB.";
J. Virol. 82:4585-4594(2008).
[52] {ECO:0000305}
INVOLVEMENT IN MULTIPLE MYELOMA.
PubMed=18202175; DOI=10.1073/pnas.0711293105;
Jinushi M., Vanneman M., Munshi N.C., Tai Y.-T., Prabhala R.H.,
Ritz J., Neuberg D., Anderson K.C., Carrasco D.R., Dranoff G.;
"MHC class I chain-related protein A antibodies and shedding are
associated with the progression of multiple myeloma.";
Proc. Natl. Acad. Sci. U.S.A. 105:1285-1290(2008).
[53] {ECO:0000305}
X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 24-297, AND DISULFIDE BONDS.
PubMed=10367903; DOI=10.1016/S1074-7613(00)80057-6;
Li P., Willie S.T., Bauer S., Morris D.L., Spies T., Strong R.K.;
"Crystal structure of the MHC class I homolog MIC-A, a gammadelta T
cell ligand.";
Immunity 10:577-584(1999).
[54] {ECO:0000305, ECO:0000312|PDB:1HYR}
X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) OF 24-297 IN COMPLEX WITH KLRK1.
PubMed=11323699; DOI=10.1038/87757;
Li P., Morris D.L., Willcox B.E., Steinle A., Spies T., Strong R.K.;
"Complex structure of the activating immunoreceptor NKG2D and its MHC
class I-like ligand MICA.";
Nat. Immunol. 2:443-451(2001).
-!- FUNCTION: Seems to have no role in antigen presentation. Acts as a
stress-induced self-antigen that is recognized by gamma delta T-
cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads
to cell lysis. {ECO:0000269|PubMed:10426993,
ECO:0000269|PubMed:11224526, ECO:0000269|PubMed:11491531,
ECO:0000269|PubMed:11777960, ECO:0000269|PubMed:9497295}.
-!- SUBUNIT: Unlike classical MHC class I molecules, does not form a
heterodimer with beta-2-microglobulin. Binds as a monomer to a
KLRK1/NKG2D homodimer. KLRK1 forms a complex with HCST/DAP10 in
which KLRK1 binds MICA while HCST acts as an adapter molecule
which enables signal transduction. Interacts with PDIA6 on the
surface of tumor cells, leading to disulfide bond reduction which
is required for release of MICA from tumor cells. Interacts with
human cytomegalovirus/HHV-5 protein UL142.
{ECO:0000269|PubMed:10426993, ECO:0000269|PubMed:10426994,
ECO:0000269|PubMed:11323699, ECO:0000269|PubMed:11491531,
ECO:0000269|PubMed:17495932, ECO:0000269|PubMed:19793804,
ECO:0000269|PubMed:8901601, ECO:0000269|PubMed:9396860}.
-!- INTERACTION:
P26718:KLRK1; NbExp=2; IntAct=EBI-1031130, EBI-458344;
P17931:LGALS3; NbExp=2; IntAct=EBI-1031130, EBI-1170392;
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:10363723,
ECO:0000269|PubMed:18287244, ECO:0000269|PubMed:8901601}; Single-
pass type I membrane protein {ECO:0000269|PubMed:10363723,
ECO:0000269|PubMed:18287244, ECO:0000269|PubMed:8901601}.
Cytoplasm {ECO:0000269|PubMed:10363723,
ECO:0000269|PubMed:18287244, ECO:0000269|PubMed:8901601}.
Note=Expressed on the cell surface in gastric epithelium,
endothelial cells and fibroblasts and in the cytoplasm in
keratinocytes and monocytes. Infection with human adenovirus 5
suppresses cell surface expression due to the adenoviral E3-19K
protein which causes retention in the endoplasmic reticulum.
{ECO:0000269|PubMed:10363723, ECO:0000269|PubMed:18287244,
ECO:0000269|PubMed:8901601}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1 {ECO:0000269|PubMed:12466900}; Synonyms=MICA1
{ECO:0000269|PubMed:12466900};
IsoId=Q29983-1; Sequence=Displayed;
Name=2 {ECO:0000269|PubMed:12466900}; Synonyms=MICA2
{ECO:0000269|PubMed:12466900};
IsoId=Q29983-2; Sequence=VSP_055366;
Note=Found in about 10% of examined clones.;
-!- TISSUE SPECIFICITY: Widely expressed with the exception of the
central nervous system where it is absent. Expressed predominantly
in gastric epithelium and also in monocytes, keratinocytes,
endothelial cells, fibroblasts and in the outer layer of Hassal's
corpuscles within the medulla of normal thymus. In skin, expressed
mainly in the keratin layers, basal cells, ducts and follicles.
Also expressed in many, but not all, epithelial tumors of lung,
breast, kidney, ovary, prostate and colon. In thyomas,
overexpressed in cortical and medullar epithelial cells. Tumors
expressing MICA display increased levels of gamma delta T-cells.
{ECO:0000269|PubMed:10359807, ECO:0000269|PubMed:10363723,
ECO:0000269|PubMed:10691930, ECO:0000269|PubMed:12902493,
ECO:0000269|PubMed:17565371, ECO:0000269|PubMed:8901601,
ECO:0000269|PubMed:9396860}.
-!- INDUCTION: By heat shock, by infection with human cytomegalovirus
(HCMV), human adenovirus 5, M.tuberculosis and diarrheagenic
E.coli, and by exposure to DNA damaging conditions such as high
doses of ionizing radiation, chromatin-modifying treatments and
inhibitors of DNA replication. The HCMV UL142 protein causes down-
regulation of the full-length protein but not of the truncated
MICA*008 allele. {ECO:0000269|PubMed:11224526,
ECO:0000269|PubMed:11485740, ECO:0000269|PubMed:11830641,
ECO:0000269|PubMed:15995699, ECO:0000269|PubMed:16750166,
ECO:0000269|PubMed:18287244, ECO:0000269|PubMed:8901601,
ECO:0000269|PubMed:9497295}.
-!- PTM: N-glycosylated. Glycosylation is not essential for
interaction with KLRK1/NKG2D but enhances complex formation.
{ECO:0000269|PubMed:8901601}.
-!- PTM: Proteolytically cleaved and released from the cell surface of
tumor cells which impairs KLRK1/NKG2D expression and T-cell
activation. {ECO:0000269|PubMed:12370336,
ECO:0000269|PubMed:12384702}.
-!- POLYMORPHISM: The following alleles of MICA are known: MICA*001,
MICA*002, MICA*004, MICA*005, MICA*006, MICA*007, MICA*008,
MICA*009, MICA*010, MICA*011, MICA*012, MICA*013, MICA*014,
MICA*015, MICA*016, MICA*017, MICA*018, MICA*019, MICA*020,
MICA*022, MICA*023, MICA*024, MICA*025, MICA*026, MICA*027,
MICA*028, MICA*029, MICA*030, MICA*031, MICA*032, MICA*033,
MICA*034, MICA*035, MICA*036, MICA*037, MICA*038, MICA*039,
MICA*040, MICA*041, MICA*042, MICA*043, MICA*044, MICA*045,
MICA*046, MICA*047, MICA*048, MICA*049, MICA*050, MICA*051,
MICA*052, MICA*053, MICA*054, MICA*055 and MICA*056. The sequence
shown is that of MICA*001. {ECO:0000305}.
-!- DISEASE: Note=Anti-MICA antibodies and ligand shedding are
involved in the progression of monoclonal gammopathy of
undetermined significance (MGUS)to multiple myeloma.
-!- DISEASE: Psoriasis 1 (PSORS1) [MIM:177900]: A common, chronic
inflammatory disease of the skin with multifactorial etiology. It
is characterized by red, scaly plaques usually found on the scalp,
elbows and knees. These lesions are caused by abnormal
keratinocyte proliferation and infiltration of inflammatory cells
into the dermis and epidermis. Note=Disease susceptibility is
associated with variations affecting the gene represented in this
entry.
-!- DISEASE: Psoriatic arthritis (PSORAS) [MIM:607507]: An
inflammatory, seronegative arthritis associated with psoriasis. It
is a heterogeneous disorder ranging from a mild, non-destructive
disease to a severe, progressive, erosive arthropathy. Five types
of psoriatic arthritis have been defined: asymmetrical
oligoarthritis characterized by primary involvement of the small
joints of the fingers or toes; asymmetrical arthritis which
involves the joints of the extremities; symmetrical polyarthritis
characterized by a rheumatoid like pattern that can involve hands,
wrists, ankles, and feet; arthritis mutilans, which is a rare but
deforming and destructive condition; arthritis of the sacroiliac
joints and spine (psoriatic spondylitis).
{ECO:0000269|PubMed:10323458}. Note=Disease susceptibility is
associated with variations affecting the gene represented in this
entry.
-!- MISCELLANEOUS: Recognized by antibodies in the sera of some organ
transplant recipients and may be a target molecule in allograft
rejection. {ECO:0000269|PubMed:11053635}.
-!- SIMILARITY: Belongs to the MHC class I family. MIC subfamily.
{ECO:0000255}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; L14848; AAA21718.1; -; mRNA.
EMBL; X92841; CAA63427.1; -; Genomic_DNA.
EMBL; AL845443; CAI41907.1; -; Genomic_DNA.
EMBL; CR847852; CAQ11015.1; -; Genomic_DNA.
EMBL; BC016929; AAH16929.1; -; mRNA.
EMBL; BG114064; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; L29406; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; L29408; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; L29409; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; L29411; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; U56940; AAB41060.1; -; Genomic_DNA.
EMBL; U56941; AAB41061.1; -; Genomic_DNA.
EMBL; U56942; AAB41062.1; -; Genomic_DNA.
EMBL; U56943; AAB41063.1; -; Genomic_DNA.
EMBL; U56944; AAB41064.1; -; Genomic_DNA.
EMBL; U56945; AAB41065.1; -; Genomic_DNA.
EMBL; U56946; AAB41066.1; -; Genomic_DNA.
EMBL; U56947; AAB41067.1; -; Genomic_DNA.
EMBL; U56948; AAB41068.1; -; Genomic_DNA.
EMBL; U56949; AAB41069.1; -; Genomic_DNA.
EMBL; U56950; AAB41070.1; -; Genomic_DNA.
EMBL; U56951; AAB41071.1; -; Genomic_DNA.
EMBL; U56952; AAB41072.1; -; Genomic_DNA.
EMBL; U56953; AAB41073.1; -; Genomic_DNA.
EMBL; U56954; AAB41074.1; -; Genomic_DNA.
EMBL; U56955; AAB41075.1; -; Genomic_DNA.
EMBL; Y16801; CAA76393.1; -; Genomic_DNA.
EMBL; Y16802; CAA76394.1; -; Genomic_DNA.
EMBL; Y16803; CAA76395.1; -; Genomic_DNA.
EMBL; Y16804; CAA76396.1; -; Genomic_DNA.
EMBL; Y16805; CAA76397.1; -; Genomic_DNA.
EMBL; Y16806; CAA76398.1; -; Genomic_DNA.
EMBL; Y16807; CAA76399.1; -; Genomic_DNA.
EMBL; Y16808; CAA76400.1; -; Genomic_DNA.
EMBL; Y16809; CAA76401.1; -; Genomic_DNA.
EMBL; Y16810; CAA76402.1; -; Genomic_DNA.
EMBL; Y16811; CAA76403.1; -; Genomic_DNA.
EMBL; Y18110; CAA77029.1; -; Genomic_DNA.
EMBL; Y18111; CAA77030.1; -; Genomic_DNA.
EMBL; Y18112; CAA77031.1; -; Genomic_DNA.
EMBL; AF097403; AAD27006.1; -; Genomic_DNA.
EMBL; AF097404; AAD27007.1; -; Genomic_DNA.
EMBL; AF097405; AAD27008.1; -; Genomic_DNA.
EMBL; AF097406; AAD27009.1; -; Genomic_DNA.
EMBL; AB015600; BAA29034.1; -; Genomic_DNA.
EMBL; AJ563426; CAD91415.1; -; Genomic_DNA.
EMBL; AH007168; AAD01474.1; -; Genomic_DNA.
EMBL; AH007170; AAD01476.1; -; Genomic_DNA.
EMBL; AH007171; AAD01477.1; -; Genomic_DNA.
EMBL; AH007173; AAD01479.1; -; Genomic_DNA.
EMBL; AH007174; AAD01480.1; -; Genomic_DNA.
EMBL; AH007186; AAD01492.1; -; Genomic_DNA.
EMBL; AH007175; AAD01481.1; -; Genomic_DNA.
EMBL; AH007176; AAD01482.1; -; Genomic_DNA.
EMBL; AH007177; AAD01483.1; -; Genomic_DNA.
EMBL; AH007178; AAD01484.1; -; Genomic_DNA.
EMBL; AH007179; AAD01485.1; -; Genomic_DNA.
EMBL; AH007180; AAD01486.1; -; Genomic_DNA.
EMBL; AH007182; AAD01488.1; -; Genomic_DNA.
EMBL; AH007183; AAD01489.1; -; Genomic_DNA.
EMBL; AH007184; AAD01490.1; -; Genomic_DNA.
EMBL; AH007185; AAD01491.1; -; Genomic_DNA.
EMBL; AH008136; AAD52060.1; -; Genomic_DNA.
EMBL; AH008137; AAD52061.1; -; Genomic_DNA.
EMBL; AH008138; AAD52062.1; -; Genomic_DNA.
EMBL; AH008139; AAD52063.1; -; Genomic_DNA.
EMBL; AH008140; AAD52064.1; -; Genomic_DNA.
EMBL; AH008141; AAD52065.1; -; Genomic_DNA.
EMBL; AH008142; AAD52066.1; -; Genomic_DNA.
EMBL; AH008143; AAD52067.1; -; Genomic_DNA.
EMBL; AH008144; AAD52068.1; -; Genomic_DNA.
EMBL; AH008145; AAD52069.1; -; Genomic_DNA.
EMBL; AH008146; AAD52070.1; -; Genomic_DNA.
EMBL; AH008147; AAD52071.1; -; Genomic_DNA.
EMBL; AH008148; AAD52072.1; -; Genomic_DNA.
EMBL; AH007169; AAD01475.1; -; Genomic_DNA.
EMBL; AH007172; AAD01478.1; -; Genomic_DNA.
EMBL; AH007167; AAD01473.1; -; Genomic_DNA.
EMBL; AH007181; AAD01487.1; -; Genomic_DNA.
EMBL; AH010819; AAK58536.1; -; Genomic_DNA.
EMBL; AH011143; AAL13171.1; -; Genomic_DNA.
EMBL; AH010820; AAK58537.1; -; Genomic_DNA.
EMBL; AH010821; AAK58538.1; -; Genomic_DNA.
EMBL; AH010545; AAK19622.1; -; Genomic_DNA.
EMBL; AH010526; AAK17997.1; -; Genomic_DNA.
EMBL; AH010568; AAK25770.1; -; Genomic_DNA.
EMBL; AH010569; AAK25771.1; -; Genomic_DNA.
EMBL; AH010532; AAK18281.1; -; Genomic_DNA.
EMBL; AH010546; AAK19623.1; -; Genomic_DNA.
EMBL; AH010560; AAK20897.1; -; Genomic_DNA.
EMBL; AH010561; AAK20898.1; -; Genomic_DNA.
EMBL; AH010587; AAK27364.1; -; Genomic_DNA.
EMBL; AH010562; AAK20899.1; -; Genomic_DNA.
EMBL; AH010571; AAK26323.1; -; Genomic_DNA.
EMBL; AH010572; AAK26324.1; -; Genomic_DNA.
EMBL; AH010740; AAK51140.1; -; Genomic_DNA.
EMBL; AJ250499; CAC14280.1; -; Genomic_DNA.
EMBL; AJ250500; CAC14281.1; -; Genomic_DNA.
EMBL; AJ250501; CAC14282.1; -; Genomic_DNA.
EMBL; AJ250502; CAC14283.1; -; Genomic_DNA.
EMBL; AJ250503; CAC14284.1; -; Genomic_DNA.
EMBL; AJ250504; CAC14285.1; -; Genomic_DNA.
EMBL; AJ250505; CAC14286.1; -; Genomic_DNA.
EMBL; AJ250506; CAC14287.1; -; Genomic_DNA.
EMBL; AJ250507; CAC14288.1; -; Genomic_DNA.
EMBL; AJ250802; CAC15380.1; -; Genomic_DNA.
EMBL; AJ250803; CAC15381.1; -; Genomic_DNA.
EMBL; AJ250804; CAC15382.1; -; Genomic_DNA.
EMBL; AJ250805; CAC15383.1; -; Genomic_DNA.
EMBL; AJ250990; CAC16142.1; -; Genomic_DNA.
EMBL; AJ250991; CAC16143.1; -; Genomic_DNA.
EMBL; AJ271789; CAC27561.1; -; Genomic_DNA.
EMBL; AY603357; AAV39504.1; -; Genomic_DNA.
EMBL; AJ249394; CAB71317.1; -; Genomic_DNA.
EMBL; AJ295250; CAC88121.1; -; Genomic_DNA.
EMBL; AJ295251; CAC88121.1; JOINED; Genomic_DNA.
EMBL; AJ580805; CAE45581.1; -; Genomic_DNA.
EMBL; AJ580806; CAE45582.2; -; Genomic_DNA.
EMBL; AH014149; AAU95382.1; -; Genomic_DNA.
EMBL; AM899996; CAP12057.1; -; Genomic_DNA.
EMBL; EU254723; ABX54884.1; -; Genomic_DNA.
EMBL; AM944063; CAQ16171.1; -; Genomic_DNA.
EMBL; AH006330; AAC28941.1; -; Genomic_DNA.
EMBL; AH006331; AAC28942.1; -; Genomic_DNA.
EMBL; AH006332; AAC28943.1; -; Genomic_DNA.
EMBL; AH006333; AAC28944.1; -; Genomic_DNA.
EMBL; AH006334; AAC28945.1; -; Genomic_DNA.
EMBL; AH007472; AAD19598.1; -; Genomic_DNA.
EMBL; AH007473; AAD19599.1; -; Genomic_DNA.
EMBL; AH007474; AAD19600.1; -; Genomic_DNA.
EMBL; AH007475; AAD19601.1; -; Genomic_DNA.
EMBL; AH007476; AAD19602.1; -; Genomic_DNA.
EMBL; AH007477; AAD19603.1; -; Genomic_DNA.
EMBL; AF106652; AAD19604.1; -; Genomic_DNA.
EMBL; AF106650; AAD19604.1; JOINED; Genomic_DNA.
EMBL; AF106651; AAD19604.1; JOINED; Genomic_DNA.
EMBL; AH007479; AAD19605.1; -; Genomic_DNA.
EMBL; EU267602; ABX60404.1; -; Genomic_DNA.
EMBL; AY095537; AAM34484.1; -; Genomic_DNA.
PIR; A55739; A55739.
RefSeq; NP_000238.1; NM_000247.2. [Q29983-1]
UniGene; Hs.130838; -.
PDB; 1B3J; X-ray; 3.00 A; A=24-297.
PDB; 1HYR; X-ray; 2.70 A; C=24-297.
PDBsum; 1B3J; -.
PDBsum; 1HYR; -.
DisProt; DP00670; -.
ProteinModelPortal; Q29983; -.
SMR; Q29983; -.
BioGrid; 319735; 41.
CORUM; Q29983; -.
DIP; DIP-29681N; -.
IntAct; Q29983; 3.
MINT; MINT-8214461; -.
iPTMnet; Q29983; -.
PhosphoSitePlus; Q29983; -.
SwissPalm; Q29983; -.
DMDM; 74740024; -.
EPD; Q29983; -.
MaxQB; Q29983; -.
PeptideAtlas; Q29983; -.
PRIDE; Q29983; -.
Ensembl; ENST00000400325; ENSP00000383179; ENSG00000183214. [Q29983-1]
Ensembl; ENST00000418465; ENSP00000402134; ENSG00000235233.
Ensembl; ENST00000547609; ENSP00000446963; ENSG00000183214. [Q29983-1]
GeneID; 100507436; -.
KEGG; hsa:100507436; -.
UCSC; uc011ind.3; human. [Q29983-1]
CTD; 100507436; -.
DisGeNET; 100507436; -.
GeneCards; MICA; -.
HGNC; HGNC:7090; MICA.
HPA; HPA064618; -.
MIM; 177900; phenotype.
MIM; 600169; gene.
MIM; 607507; phenotype.
neXtProt; NX_Q29983; -.
PharmGKB; PA30811; -.
HOVERGEN; HBG106364; -.
InParanoid; Q29983; -.
KO; K07985; -.
OrthoDB; EOG091G0ANY; -.
PhylomeDB; Q29983; -.
Reactome; R-HSA-198933; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
ChiTaRS; MICA; human.
EvolutionaryTrace; Q29983; -.
GeneWiki; MHC_class_I_polypeptide-related_sequence_A; -.
GenomeRNAi; 100507436; -.
PMAP-CutDB; Q29983; -.
PRO; PR:Q29983; -.
Proteomes; UP000005640; Chromosome 6.
GO; GO:0009986; C:cell surface; IDA:UniProtKB.
GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell.
GO; GO:0005615; C:extracellular space; IDA:BHF-UCL.
GO; GO:0005887; C:integral component of plasma membrane; IDA:BHF-UCL.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0046703; F:natural killer cell lectin-like receptor binding; IDA:UniProtKB.
GO; GO:0006974; P:cellular response to DNA damage stimulus; IDA:UniProtKB.
GO; GO:0019835; P:cytolysis; IEA:UniProtKB-KW.
GO; GO:0042742; P:defense response to bacterium; IDA:UniProtKB.
GO; GO:0051607; P:defense response to virus; IDA:UniProtKB.
GO; GO:0046629; P:gamma-delta T cell activation; IDA:UniProtKB.
GO; GO:0002418; P:immune response to tumor cell; IDA:UniProtKB.
GO; GO:0042267; P:natural killer cell mediated cytotoxicity; IDA:UniProtKB.
GO; GO:0032815; P:negative regulation of natural killer cell activation; IDA:CACAO.
GO; GO:0045953; P:negative regulation of natural killer cell mediated cytotoxicity; IMP:CACAO.
GO; GO:0050776; P:regulation of immune response; TAS:Reactome.
GO; GO:0009408; P:response to heat; IDA:UniProtKB.
GO; GO:0001913; P:T cell mediated cytotoxicity; IDA:UniProtKB.
GO; GO:0016032; P:viral process; IEA:UniProtKB-KW.
Gene3D; 2.60.40.10; -; 1.
Gene3D; 3.30.500.10; -; 1.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003597; Ig_C1-set.
InterPro; IPR011161; MHC_I-like_Ag-recog.
InterPro; IPR011162; MHC_I/II-like_Ag-recog.
Pfam; PF07654; C1-set; 1.
Pfam; PF00129; MHC_I; 1.
SMART; SM00407; IGc1; 1.
SUPFAM; SSF48726; SSF48726; 1.
SUPFAM; SSF54452; SSF54452; 1.
PROSITE; PS50835; IG_LIKE; 1.
1: Evidence at protein level;
3D-structure; Adaptive immunity; Alternative splicing; Cell membrane;
Complete proteome; Cytolysis; Cytoplasm; Disulfide bond; Glycoprotein;
Host-virus interaction; Immunity; Immunoglobulin domain; Membrane;
Polymorphism; Reference proteome; Signal; Transmembrane;
Transmembrane helix.
SIGNAL 1 23
CHAIN 24 383 MHC class I polypeptide-related sequence
A. {ECO:0000255}.
/FTId=PRO_0000337146.
TOPO_DOM 24 307 Extracellular. {ECO:0000255}.
TRANSMEM 308 328 Helical. {ECO:0000255}.
TOPO_DOM 329 383 Cytoplasmic. {ECO:0000255}.
DOMAIN 207 296 Ig-like C1-type. {ECO:0000255}.
CARBOHYD 31 31 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 79 79 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 210 210 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 220 220 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 261 261 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 59 64 {ECO:0000255|PROSITE-ProRule:PRU00114,
ECO:0000269|PubMed:10367903}.
DISULFID 119 187 {ECO:0000255|PROSITE-ProRule:PRU00114,
ECO:0000269|PubMed:10367903}.
DISULFID 225 282 {ECO:0000255|PROSITE-ProRule:PRU00114,
ECO:0000269|PubMed:10367903}.
VAR_SEQ 109 204 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_055366.
VARIANT 29 29 R -> P (in allele MICA*010, allele
MICA*025 and allele MICA*054; abolishes
cell surface expression, probably by
interfering with protein folding;
dbSNP:rs9380254).
{ECO:0000269|PubMed:10752636}.
/FTId=VAR_043625.
VARIANT 37 37 W -> G (in allele MICA*002, allele
MICA*011, allele MICA*013, allele
MICA*014, allele MICA*015, allele
MICA*017, allele MICA*020, allele
MICA*022, allele MICA*023, allele
MICA*030, allele MICA*034, allele
MICA*035, allele MICA*036, allele
MICA*041, allele MICA*044, allele
MICA*046, allele MICA*047, allele
MICA*052, allele MICA*053 and allele
MICA*055; dbSNP:rs1063630).
/FTId=VAR_043626.
VARIANT 47 47 T -> A (in allele MICA*002, allele
MICA*004, allele MICA*005, allele
MICA*006, allele MICA*007, allele
MICA*008, allele MICA*009, allele
MICA*010, allele MICA*011, allele
MICA*013, allele MICA*014, allele
MICA*015, allele MICA*016, allele
MICA*017, allele MICA*019, allele
MICA*020, allele MICA*022, allele
MICA*023, allele MICA*024, allele
MICA*025, allele MICA*026, allele
MICA*027, allele MICA*028, allele
MICA*029, allele MICA*030, allele
MICA*031, allele MICA*032, allele
MICA*033, allele MICA*034, allele
MICA*035, allele MICA*036, allele
MICA*037, allele MICA*038, allele
MICA*039, allele MICA*040, allele
MICA*041, allele MICA*042, allele
MICA*043, allele MICA*044, allele
MICA*045, allele MICA*046, allele
MICA*047, allele MICA*048, allele
MICA*049, allele MICA*051, allele
MICA*052, allele MICA*053, allele
MICA*054, allele MICA*055 and allele
MICA*056; dbSNP:rs1051785).
/FTId=VAR_043627.
VARIANT 49 49 V -> G (in allele MICA*041;
dbSNP:rs17200158).
/FTId=VAR_043628.
VARIANT 59 59 C -> Y (in allele MICA*004, allele
MICA*005, allele MICA*006, allele
MICA*008, allele MICA*009, allele
MICA*010, allele MICA*016, allele
MICA*019, allele MICA*024, allele
MICA*025, allele MICA*027, allele
MICA*028, allele MICA*031, allele
MICA*032, allele MICA*033, allele
MICA*042, allele MICA*044, allele
MICA*048, allele MICA*049, allele
MICA*051, allele MICA*054 and allele
MICA*056; dbSNP:rs1051786).
/FTId=VAR_043629.
VARIANT 114 114 Q -> R (in allele MICA*017;
dbSNP:rs41558312).
/FTId=VAR_043630.
VARIANT 128 128 R -> K (in allele MICA*036;
dbSNP:rs41557113).
/FTId=VAR_043631.
VARIANT 137 137 G -> R (in allele MICA*014 and allele
MICA*015; dbSNP:rs41556715).
/FTId=VAR_043632.
VARIANT 145 145 L -> V (in allele MICA*004, allele
MICA*006, allele MICA*009, allele
MICA*044 and allele MICA*049;
dbSNP:rs1051790).
/FTId=VAR_043633.
VARIANT 147 147 T -> S (in allele MICA*033;
dbSNP:rs41539919).
/FTId=VAR_043634.
VARIANT 148 148 K -> E (in allele MICA*002, allele
MICA*004, allele MICA*005, allele
MICA*006, allele MICA*007, allele
MICA*008, allele MICA*009, allele
MICA*010, allele MICA*011, allele
MICA*012, allele MICA*013, allele
MICA*014, allele MICA*015, allele
MICA*016, allele MICA*017, allele
MICA*018, allele MICA*019, allele
MICA*020, allele MICA*022, allele
MICA*023, allele MICA*024, allele
MICA*025, allele MICA*026, allele
MICA*027, allele MICA*028, allele
MICA*029, allele MICA*030, allele
MICA*032, allele MICA*033, allele
MICA*034, allele MICA*035, allele
MICA*036, allele MICA*037, allele
MICA*038, allele MICA*039, allele
MICA*041, allele MICA*042, allele
MICA*043, allele MICA*044, allele
MICA*045, allele MICA*046, allele
MICA*047, allele MICA*048, allele
MICA*049, allele MICA*051, allele
MICA*052, allele MICA*053, allele
MICA*054, allele MICA*055 and allele
MICA*056; dbSNP:rs1051791).
/FTId=VAR_043635.
VARIANT 152 152 M -> V (in allele MICA*004, allele
MICA*005, allele MICA*006, allele
MICA*008, allele MICA*009, allele
MICA*010, allele MICA*013, allele
MICA*016, allele MICA*019, allele
MICA*022, allele MICA*024, allele
MICA*027, allele MICA*028, allele
MICA*033, allele MICA*044, allele
MICA*048, allele MICA*049, allele
MICA*053, allele MICA*054 and allele
MICA*056; reduces binding affinity for
KLRK1; dbSNP:rs1051792).
/FTId=VAR_043636.
VARIANT 165 165 V -> I (in allele MICA*029;
dbSNP:rs3819269).
/FTId=VAR_043637.
VARIANT 174 174 M -> V (in allele MICA*011 and allele
MICA*034; dbSNP:rs41560824).
/FTId=VAR_043638.
VARIANT 179 179 H -> L (in allele MICA*012, allele
MICA*032 and allele MICA*043;
dbSNP:rs3819268).
/FTId=VAR_043639.
VARIANT 196 196 K -> E (in allele MICA*004, allele
MICA*006, allele MICA*008, allele
MICA*009, allele MICA*010, allele
MICA*013, allele MICA*014, allele
MICA*016, allele MICA*019, allele
MICA*022, allele MICA*024, allele
MICA*027, allele MICA*028, allele
MICA*033, allele MICA*036, allele
MICA*044, allele MICA*048, allele
MICA*049, allele MICA*053, allele
MICA*054 and allele MICA*056;
dbSNP:rs1051794).
/FTId=VAR_043640.
VARIANT 198 198 G -> S (in allele MICA*004, allele
MICA*006, allele MICA*009, allele
MICA*010, allele MICA*016, allele
MICA*019, allele MICA*031, allele
MICA*033, allele MICA*036, allele
MICA*044, allele MICA*049, allele
MICA*054 and allele MICA*056;
dbSNP:rs1131896).
/FTId=VAR_043641.
VARIANT 199 199 V -> I (in allele MICA*006;
dbSNP:rs41549718).
/FTId=VAR_043642.
VARIANT 204 204 T -> R (in allele MICA*004, allele
MICA*014, allele MICA*032 and allele
MICA*044; dbSNP:rs1131897).
/FTId=VAR_043643.
VARIANT 229 229 G -> S (in allele MICA*004, allele
MICA*005, allele MICA*006, allele
MICA*008, allele MICA*009, allele
MICA*010, allele MICA*016, allele
MICA*019, allele MICA*022, allele
MICA*024, allele MICA*027, allele
MICA*033, allele MICA*034, allele
MICA*035, allele MICA*037, allele
MICA*038, allele MICA*039, allele
MICA*042, allele MICA*044, allele
MICA*048, allele MICA*049, allele
MICA*053, allele MICA*054 and allele
MICA*056; dbSNP:rs1131898).
/FTId=VAR_043644.
VARIANT 231 231 Y -> C (in allele MICA*046;
dbSNP:rs41546915).
/FTId=VAR_043645.
VARIANT 233 233 W -> R (in allele MICA*004, allele
MICA*005, allele MICA*006, allele
MICA*008, allele MICA*009, allele
MICA*010, allele MICA*016, allele
MICA*019, allele MICA*022, allele
MICA*024, allele MICA*027, allele
MICA*033, allele MICA*034, allele
MICA*035, allele MICA*037, allele
MICA*038, allele MICA*039, allele
MICA*042, allele MICA*044, allele
MICA*048, allele MICA*049, allele
MICA*053, allele MICA*054 and allele
MICA*056; dbSNP:rs1051798).
/FTId=VAR_043646.
VARIANT 236 236 T -> I (in allele MICA*008, allele
MICA*010, allele MICA*016, allele
MICA*019, allele MICA*022, allele
MICA*027, allele MICA*033, allele
MICA*035, allele MICA*037, allele
MICA*039, allele MICA*042, allele
MICA*048, allele MICA*053, allele
MICA*054 and allele MICA*056;
dbSNP:rs1140700).
/FTId=VAR_043647.
VARIANT 238 238 S -> T (in allele MICA*004, allele
MICA*006, allele MICA*008, allele
MICA*009, allele MICA*010, allele
MICA*016, allele MICA*019, allele
MICA*022, allele MICA*024, allele
MICA*027, allele MICA*033, allele
MICA*034, allele MICA*035, allele
MICA*037, allele MICA*038, allele
MICA*039, allele MICA*042, allele
MICA*044, allele MICA*048, allele
MICA*049, allele MICA*053, allele
MICA*054 and allele MICA*056;
dbSNP:rs1051799).
/FTId=VAR_043648.
VARIANT 244 244 V -> L (in allele MICA*016 and allele
MICA*039; dbSNP:rs41540613).
/FTId=VAR_043649.
VARIANT 253 253 W -> S (in allele MICA*056;
dbSNP:rs72558175).
/FTId=VAR_043869.
VARIANT 274 274 Q -> R (in allele MICA*005, allele
MICA*008, allele MICA*010, allele
MICA*013, allele MICA*016, allele
MICA*019, allele MICA*022, allele
MICA*027, allele MICA*033, allele
MICA*035, allele MICA*037, allele
MICA*039, allele MICA*042, allele
MICA*045, allele MICA*048, allele
MICA*053, allele MICA*054 and allele
MICA*056; dbSNP:rs1063635).
/FTId=VAR_043650.
VARIANT 279 279 R -> S (in allele MICA*043;
dbSNP:rs41557614).
/FTId=VAR_043651.
VARIANT 291 291 S -> G (in allele MICA*054;
dbSNP:rs61759927).
/FTId=VAR_043652.
VARIANT 294 294 P -> A (in allele MICA*011, allele
MICA*030 and allele MICA*047;
dbSNP:rs41553616).
/FTId=VAR_043653.
VARIANT 300 383 VLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEG
PELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTE
GA -> CWCFRVIGRHSMFLLLLLLLLLLLLFLLLLFSTSV
VVRRKHQLQRVQSS (in allele MICA*015 and
allele MICA*017).
/FTId=VAR_043654.
VARIANT 318 383 AAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSD
HRDATQLGFQPLMSDLGSTGSTEGA -> GCCYFCYYYFLC
PLL (in allele MICA*008, allele MICA*023,
allele MICA*028 and allele MICA*053).
/FTId=VAR_043655.
VARIANT 319 319 A -> AA (in allele MICA*010, allele
MICA*016, allele MICA*019, allele
MICA*027, allele MICA*033, allele
MICA*048, allele MICA*054 and allele
MICA*056).
/FTId=VAR_043656.
VARIANT 319 319 A -> AAA (in allele MICA*004, allele
MICA*006, allele MICA*009, allele
MICA*011, allele MICA*026, allele
MICA*047 and allele MICA*049).
/FTId=VAR_043657.
VARIANT 319 319 A -> AAAA (in allele MICA*050).
/FTId=VAR_043658.
VARIANT 319 319 A -> AAAAA (in allele MICA*055).
/FTId=VAR_043659.
VARIANT 319 319 A -> AAAAAA (in allele MICA*002, allele
MICA*041, allele MICA*046 and allele
MICA*052).
/FTId=VAR_043660.
VARIANT 319 319 A -> AAAAAAA (in allele MICA*020).
/FTId=VAR_043661.
VARIANT 328 328 V -> I (in allele MICA*052;
dbSNP:rs72558178).
/FTId=VAR_043662.
VARIANT 329 329 R -> C (in allele MICA*002, allele
MICA*011, allele MICA*020, allele
MICA*041, allele MICA*043, allele
MICA*046, allele MICA*047, allele
MICA*050 and allele MICA*052;
dbSNP:rs41554412).
/FTId=VAR_043663.
VARIANT 356 356 T -> M (in allele MICA*049;
dbSNP:rs41546114).
/FTId=VAR_043664.
VARIANT 373 373 D -> A (in allele MICA*004, allele
MICA*006, allele MICA*010, allele
MICA*011, allele MICA*016, allele
MICA*019, allele MICA*048 and allele
MICA*049; dbSNP:rs9266825).
/FTId=VAR_043665.
VARIANT 377 377 T -> A (in allele MICA*011;
dbSNP:rs41545814).
/FTId=VAR_043666.
VARIANT 383 383 A -> T (in allele MICA*018;
dbSNP:rs1882).
/FTId=VAR_043667.
STRAND 26 37 {ECO:0000244|PDB:1HYR}.
STRAND 40 51 {ECO:0000244|PDB:1HYR}.
STRAND 54 59 {ECO:0000244|PDB:1HYR}.
STRAND 64 66 {ECO:0000244|PDB:1HYR}.
STRAND 71 75 {ECO:0000244|PDB:1HYR}.
HELIX 79 81 {ECO:0000244|PDB:1HYR}.
HELIX 82 101 {ECO:0000244|PDB:1HYR}.
STRAND 109 121 {ECO:0000244|PDB:1HYR}.
STRAND 127 135 {ECO:0000244|PDB:1HYR}.
STRAND 138 144 {ECO:0000244|PDB:1HYR}.
TURN 145 148 {ECO:0000244|PDB:1HYR}.
STRAND 149 151 {ECO:0000244|PDB:1HYR}.
HELIX 156 170 {ECO:0000244|PDB:1HYR}.
HELIX 177 196 {ECO:0000244|PDB:1HYR}.
STRAND 208 213 {ECO:0000244|PDB:1HYR}.
STRAND 217 233 {ECO:0000244|PDB:1HYR}.
STRAND 236 241 {ECO:0000244|PDB:1HYR}.
TURN 248 250 {ECO:0000244|PDB:1B3J}.
STRAND 251 253 {ECO:0000244|PDB:1HYR}.
STRAND 260 262 {ECO:0000244|PDB:1HYR}.
STRAND 264 273 {ECO:0000244|PDB:1HYR}.
HELIX 277 279 {ECO:0000244|PDB:1HYR}.
STRAND 280 286 {ECO:0000244|PDB:1HYR}.
STRAND 289 294 {ECO:0000244|PDB:1HYR}.
SEQUENCE 383 AA; 42915 MW; 1FE084813DDA13A8 CRC64;
MGLGPVFLLL AGIFPFAPPG AAAEPHSLRY NLTVLSWDGS VQSGFLTEVH LDGQPFLRCD
RQKCRAKPQG QWAEDVLGNK TWDRETRDLT GNGKDLRMTL AHIKDQKEGL HSLQEIRVCE
IHEDNSTRSS QHFYYDGELF LSQNLETKEW TMPQSSRAQT LAMNVRNFLK EDAMKTKTHY
HAMHADCLQE LRRYLKSGVV LRRTVPPMVN VTRSEASEGN ITVTCRASGF YPWNITLSWR
QDGVSLSHDT QQWGDVLPDG NGTYQTWVAT RICQGEEQRF TCYMEHSGNH STHPVPSGKV
LVLQSHWQTF HVSAVAAAAI FVIIIFYVRC CKKKTSAAEG PELVSLQVLD QHPVGTSDHR
DATQLGFQPL MSDLGSTGST EGA


Related products :

Catalog number Product name Quantity
EH015 MHC class I polypeptide-related sequence A Elisa Kit 96T
CG11 MHC Class I Polypeptide-Related Sequence A MICA (C-Fc-His tag) 500
C489 MHC Class I Polypeptide-Related Sequence A MICA (C-His tag) 500
E02M0274 Rat MHC class I polypeptide-related sequence A ELISA 96T/kit
CG11 MHC Class I Polypeptide-Related Sequence A MICA (C-Fc-His tag) lmg
C489 MHC Class I Polypeptide-Related Sequence A MICA (C-His tag) lmg
E02M0275 Rat MHC class I polypeptide-related sequence B ELISA 96T/kit
CG11 Human MHC Class I Polypeptide-Related Sequence A MICA (C-His tag) l0
CH19 Human MHC Class I Polypeptide-Related Sequence A MICA (C-Fc-His tag) 50
C177 Human MHC Class I Polypeptide-Related Sequence A MICA (C-His tag) 50
E12M0275 Chicken MHC class I polypeptide-related sequence B ELISA 96T/kit
E07M0274 Porcine MHC class I polypeptide-related sequence A ELISA 96T/kit
E07M0275 Porcine MHC class I polypeptide-related sequence B ELISA 96T/kit
E06M0274 Goat MHC class I polypeptide-related sequence A ELISA 96T/kit
E04M0274 Rabbit MHC class I polypeptide-related sequence A ELISA 96T/kit
C177 Human MHC Class I Polypeptide-Related Sequence A MICA (C-Fc-His tag) l0
E04M0275 Rabbit MHC class I polypeptide-related sequence B ELISA 96T/kit
E06M0275 Goat MHC class I polypeptide-related sequence B ELISA 96T/kit
E05M0274 Guinea Pig MHC class I polypeptide-related sequence A ELISA 96T/kit
E01M0274 Human MHC class I polypeptide-related sequence A ELISA 96T/kit
E0124c Human ELISA Kit FOR MHC class I polypeptide-related sequence B 96T
E05M0275 Guinea Pig MHC class I polypeptide-related sequence B ELISA 96T/kit
E14M0275 Sheep MHC class I polypeptide-related sequence B ELISA 96T/kit
201-20-3377 MICA{MHC class I polypeptide-related sequence A}rabbit.pAb 0.2ml
E08M0275 Canine MHC class I polypeptide-related sequence B ELISA 96T/kit


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur