Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

MOB kinase activator-like 2 (Mob as tumor suppressor protein 2) (Dmob2) (Mps one binder kinase activator-like 2)

 MOB2_DROME              Reviewed;         566 AA.
Q8IQG1; Q5BHY7; Q8IGB4; Q8IQG2; Q9VTJ6; Q9VTJ7;
06-MAR-2007, integrated into UniProtKB/Swiss-Prot.
06-MAR-2007, sequence version 3.
25-OCT-2017, entry version 109.
RecName: Full=MOB kinase activator-like 2;
AltName: Full=Mob as tumor suppressor protein 2;
Short=Dmob2;
AltName: Full=Mps one binder kinase activator-like 2;
Name=Mob2; ORFNames=CG11711;
Drosophila melanogaster (Fruit fly).
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Holometabola; Diptera; Brachycera; Muscomorpha;
Ephydroidea; Drosophilidae; Drosophila; Sophophora.
NCBI_TaxID=7227;
[1] {ECO:0000312|EMBL:AAN11874.2}
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=Berkeley {ECO:0000269|PubMed:10731132};
PubMed=10731132; DOI=10.1126/science.287.5461.2185;
Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D.,
Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F.,
George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N.,
Sutton G.G., Wortman J.R., Yandell M.D., Zhang Q., Chen L.X.,
Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D.,
Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G.,
Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D.,
Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M.,
Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S.,
Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P.,
Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I.,
Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P.,
de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M.,
Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P.,
Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W.,
Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K.,
Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M.,
Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J.,
Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C.,
Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A.,
Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z.,
Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X.,
Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D.,
Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A.,
Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L.,
Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M.,
Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G.,
Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H.,
Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J.,
Spier E., Spradling A.C., Stapleton M., Strong R., Sun E.,
Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X.,
Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J.,
Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A.,
Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L.,
Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X.,
Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.;
"The genome sequence of Drosophila melanogaster.";
Science 287:2185-2195(2000).
[2] {ECO:0000305, ECO:0000312|EMBL:AAN11874.2}
GENOME REANNOTATION, AND ALTERNATIVE SPLICING.
STRAIN=Berkeley;
PubMed=12537572; DOI=10.1186/gb-2002-3-12-research0083;
Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S.,
Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E.,
Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P.,
Bettencourt B.R., Celniker S.E., de Grey A.D.N.J., Drysdale R.A.,
Harris N.L., Richter J., Russo S., Schroeder A.J., Shu S.Q.,
Stapleton M., Yamada C., Ashburner M., Gelbart W.M., Rubin G.M.,
Lewis S.E.;
"Annotation of the Drosophila melanogaster euchromatic genome: a
systematic review.";
Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002).
[3] {ECO:0000305, ECO:0000312|EMBL:AAN71631.1}
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM D).
STRAIN=Berkeley {ECO:0000312|EMBL:AAN71631.1};
TISSUE=Head {ECO:0000269|PubMed:12537569};
PubMed=12537569; DOI=10.1186/gb-2002-3-12-research0080;
Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M.,
George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H.,
Rubin G.M., Celniker S.E.;
"A Drosophila full-length cDNA resource.";
Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002).
[4] {ECO:0000305, ECO:0000312|EMBL:AAX33585.1}
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C).
STRAIN=Berkeley {ECO:0000312|EMBL:AAX33585.1}; TISSUE=Head;
Stapleton M., Carlson J.W., Chavez C., Frise E., George R.A.,
Pacleb J.M., Park S., Wan K.H., Yu C., Rubin G.M., Celniker S.E.;
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases.
[5] {ECO:0000305}
FUNCTION, INTERACTION WITH TRC, AND SUBCELLULAR LOCATION.
PubMed=15975907; DOI=10.1091/mbc.E05-01-0018;
He Y., Emoto K., Fang X., Ren N., Tian X., Jan Y.-N., Adler P.N.;
"Drosophila Mob family proteins interact with the related tricornered
(Trc) and warts (Wts) kinases.";
Mol. Biol. Cell 16:4139-4152(2005).
[6] {ECO:0000305}
RNA EDITING OF POSITION 91.
PubMed=17018572; DOI=10.1261/rna.254306;
Stapleton M., Carlson J.W., Celniker S.E.;
"RNA editing in Drosophila melanogaster: new targets and functional
consequences.";
RNA 12:1922-1932(2006).
-!- FUNCTION: Required for the normal morphogenesis of a variety of
polarized outgrowths including epidermal hairs, bristles, arista
laterals, and dendrites. {ECO:0000269|PubMed:15975907}.
-!- SUBUNIT: Interacts with and activates trc, also interacts with
wts. {ECO:0000269|PubMed:15975907}.
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:15975907}.
Nucleus {ECO:0000269|PubMed:15975907}. Note=Trc colocalizes with
Mob1 to the cell periphery in wing cells and wing hairs.
{ECO:0000269|PubMed:15975907}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=D {ECO:0000269|PubMed:10731132};
IsoId=Q8IQG1-1; Sequence=Displayed;
Note=No experimental confirmation available. {ECO:0000305};
Name=A {ECO:0000269|PubMed:10731132};
IsoId=Q8IQG1-2; Sequence=VSP_052339;
Note=No experimental confirmation available. {ECO:0000305};
Name=B {ECO:0000269|PubMed:10731132};
IsoId=Q8IQG1-3; Sequence=VSP_052340;
Note=No experimental confirmation available. {ECO:0000305};
Name=C {ECO:0000269|PubMed:10731132};
IsoId=Q8IQG1-4; Sequence=VSP_052341;
Note=No experimental confirmation available. {ECO:0000305};
-!- RNA EDITING: Modified_positions=91 {ECO:0000269|PubMed:17018572};
Note=Partially edited. Target of Adar.
{ECO:0000269|PubMed:17018572};
-!- SIMILARITY: Belongs to the MOB1/phocein family. {ECO:0000255}.
-!- SEQUENCE CAUTION:
Sequence=AAN71631.1; Type=Frameshift; Positions=680; Evidence={ECO:0000305};
Sequence=AAX33585.1; Type=Frameshift; Positions=Several; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AE014296; AAF50051.1; -; Genomic_DNA.
EMBL; AE014296; AAF50052.1; -; Genomic_DNA.
EMBL; AE014296; AAN11873.1; -; Genomic_DNA.
EMBL; AE014296; AAN11874.2; -; Genomic_DNA.
EMBL; BT001864; AAN71631.1; ALT_FRAME; mRNA.
EMBL; BT021437; AAX33585.1; ALT_SEQ; mRNA.
RefSeq; NP_001261713.1; NM_001274784.1. [Q8IQG1-3]
RefSeq; NP_648474.1; NM_140217.2. [Q8IQG1-4]
RefSeq; NP_729714.1; NM_168460.2. [Q8IQG1-1]
RefSeq; NP_729715.2; NM_168461.2. [Q8IQG1-2]
RefSeq; NP_729716.1; NM_168462.2. [Q8IQG1-3]
UniGene; Dm.33455; -.
ProteinModelPortal; Q8IQG1; -.
SMR; Q8IQG1; -.
BioGrid; 64660; 37.
IntAct; Q8IQG1; 9.
MINT; MINT-320791; -.
STRING; 7227.FBpp0088371; -.
PaxDb; Q8IQG1; -.
PRIDE; Q8IQG1; -.
EnsemblMetazoa; FBtr0089330; FBpp0088369; FBgn0259481. [Q8IQG1-4]
EnsemblMetazoa; FBtr0089331; FBpp0088370; FBgn0259481. [Q8IQG1-1]
EnsemblMetazoa; FBtr0089332; FBpp0088371; FBgn0259481. [Q8IQG1-2]
EnsemblMetazoa; FBtr0089333; FBpp0088372; FBgn0259481. [Q8IQG1-3]
EnsemblMetazoa; FBtr0333217; FBpp0305419; FBgn0259481. [Q8IQG1-3]
GeneID; 39293; -.
KEGG; dme:Dmel_CG11711; -.
UCSC; CG11711-RA; d. melanogaster. [Q8IQG1-1]
CTD; 81532; -.
FlyBase; FBgn0259481; Mob2.
eggNOG; KOG0440; Eukaryota.
eggNOG; ENOG410XSUJ; LUCA.
GeneTree; ENSGT00900000141080; -.
InParanoid; Q8IQG1; -.
OMA; TSYVIKC; -.
OrthoDB; EOG091G0MET; -.
ChiTaRS; Mob2; fly.
GenomeRNAi; 39293; -.
PRO; PR:Q8IQG1; -.
Proteomes; UP000000803; Chromosome 3L.
Bgee; FBgn0259481; -.
ExpressionAtlas; Q8IQG1; differential.
GO; GO:0070451; C:cell hair; IDA:FlyBase.
GO; GO:0071944; C:cell periphery; IDA:FlyBase.
GO; GO:0005737; C:cytoplasm; IDA:UniProtKB.
GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell.
GO; GO:0005886; C:plasma membrane; IDA:FlyBase.
GO; GO:0016028; C:rhabdomere; IDA:FlyBase.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0019901; F:protein kinase binding; IPI:FlyBase.
GO; GO:0000902; P:cell morphogenesis; IMP:UniProtKB.
GO; GO:0007611; P:learning or memory; IMP:FlyBase.
GO; GO:0007616; P:long-term memory; IMP:FlyBase.
GO; GO:0045886; P:negative regulation of synaptic growth at neuromuscular junction; IMP:FlyBase.
GO; GO:0008355; P:olfactory learning; IMP:FlyBase.
GO; GO:0042052; P:rhabdomere development; IMP:FlyBase.
Gene3D; 1.20.140.30; -; 1.
InterPro; IPR005301; MOB_kinase_act_fam.
InterPro; IPR036703; MOB_kinase_act_sf.
PANTHER; PTHR22599; PTHR22599; 1.
Pfam; PF03637; Mob1_phocein; 1.
SMART; SM01388; Mob1_phocein; 1.
SUPFAM; SSF101152; SSF101152; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Cytoplasm; Metal-binding;
Nucleus; Reference proteome; RNA editing; Zinc.
CHAIN 1 566 MOB kinase activator-like 2.
/FTId=PRO_0000279701.
COMPBIAS 84 120 Gly-rich. {ECO:0000255}.
COMPBIAS 488 509 Asn-rich. {ECO:0000255}.
COMPBIAS 506 525 His-rich. {ECO:0000255}.
METAL 209 209 Zinc. {ECO:0000250|UniProtKB:Q9H8S9}.
METAL 214 214 Zinc. {ECO:0000250|UniProtKB:Q9H8S9}.
METAL 289 289 Zinc. {ECO:0000250|UniProtKB:Q9H8S9}.
METAL 294 294 Zinc. {ECO:0000250|UniProtKB:Q9H8S9}.
VAR_SEQ 2 137 NWAISNLTGGNRVSRAILVRYSSVPLADATNDGSSTAPQTP
TASTPRPSSSHSSLSSTFAATFLHASSRHIPGRAVPRQNAN
GQNGGKGNASGAGGGAGGGGAGGASGGTGGTGAQAAGQLSL
PLDVEETVTCFCR -> LRAPTQHIVQIGFGTKTTTTTTTT
AAAAAATSTAAAATPGGKQQQQRKTLLQRFRQQQHKLPKVA
AAEQTTHDTEYYFKQQQQQQTSSYQQGDNCLLYLATTLNSN
SEQLLKKSKKKKESSSYNFAAALRRNKKPKQQQQQLATSTD
DDDSCRSINSINSNCSNSSTSGSSHSLSNSCINNHNNTHYR
NSKNTRHSSSNNNDYSGNYNCKTSEQQAWKASAAQQLLISD
RNYPSSNTNNTNNNTNNITNSSNNNHSGGHIIMSPTSQAPT
RTSLFDSCHRKIRLIGGGPVAFLGGLVA (in isoform
A). {ECO:0000303|PubMed:10731132}.
/FTId=VSP_052339.
VAR_SEQ 2 137 NWAISNLTGGNRVSRAILVRYSSVPLADATNDGSSTAPQTP
TASTPRPSSSHSSLSSTFAATFLHASSRHIPGRAVPRQNAN
GQNGGKGNASGAGGGAGGGGAGGASGGTGGTGAQAAGQLSL
PLDVEETVTCFCR -> KETLSSKVPTRIGVTFVSESDPKK
KFKSSPSTSSSTISTATITSTTTTTTTTASPPPPQTSYVIK
CLLKTARFMWQVTTIPSKIGDTIGTLYRYAQDSVDSFLCVA
G (in isoform B).
{ECO:0000303|PubMed:10731132}.
/FTId=VSP_052340.
VAR_SEQ 2 137 NWAISNLTGGNRVSRAILVRYSSVPLADATNDGSSTAPQTP
TASTPRPSSSHSSLSSTFAATFLHASSRHIPGRAVPRQNAN
GQNGGKGNASGAGGGAGGGGAGGASGGTGGTGAQAAGQLSL
PLDVEETVTCFCR -> G (in isoform C).
{ECO:0000303|PubMed:10731132,
ECO:0000303|Ref.4}.
/FTId=VSP_052341.
VARIANT 91 91 N -> D (in RNA edited version).
{ECO:0000269|PubMed:17018572}.
SEQUENCE 566 AA; 58907 MW; 1D3F57A2659DEC2C CRC64;
MNWAISNLTG GNRVSRAILV RYSSVPLADA TNDGSSTAPQ TPTASTPRPS SSHSSLSSTF
AATFLHASSR HIPGRAVPRQ NANGQNGGKG NASGAGGGAG GGGAGGASGG TGGTGAQAAG
QLSLPLDVEE TVTCFCRKAR RKERDGDQNS TDTKLYLEES VLERKLPEAD LKALVDLPAG
LDYNEWLASH TLALFEHVNL VYGTISEFCT QSGCADMTGP GNRTYLWFDE KGKKTRVAAP
QYIDYVMTFT QKTVSDESIF PTKYANEFPG SFESIARKIL RLQFHVIAHL YAAHFREIAL
LGLHTHLNLT FAHLTALHRR FNLIDEKETD VLRDLEVALR LTDDTGGCQD ATSTTSSVHD
HSHSGDLQHQ SLQQQQQHHN SSSNSTSSAE AFHVNSQSNN GSTSASASVS LIDGDAVAPP
ICTQPEAGAG CKPAGSSGLL GGILGDLTSG EFGDTTRYCT SAVPQAAAAA GAGVGGTAIG
ATDAAALNNG AGALHLNFSN NNNNNHNLNH HHHHHHHHGH HGHHHAAQQQ QQHSGLIQCN
AAGGGGNATG VATGGATAAA SSTTTA


Related products :

Catalog number Product name Quantity
E2913h Human Mps One Binder Kinase Activator Like Protein 96T
E7667h Human Mps One Binder Kinase Activator Like Protein 96T
E6854h Human Mps One Binder Kinase Activator Like Protein 96T
E2914h Human Mps One Binder Kinase Activator Like Protein 96T
18-662-20092 Dual specificity mitogen-activated protein kinase kinase 1 - EC 2.7.12.2; MAP kinase kinase 1; MAPKK 1; ERK activator kinase 1; MAPK_ERK kinase 1; MEK1 Polyclonal 0.1 ml
15-288-21068 Dual specificity mitogen-activated protein kinase kinase 1 - EC 2.7.12.2; MAP kinase kinase 1; MAPKK 1; ERK activator kinase 1; MAPK_ERK kinase 1; MEK1 Polyclonal 0.05 mg
15-288-21068 Dual specificity mitogen-activated protein kinase kinase 1 - EC 2.7.12.2; MAP kinase kinase 1; MAPKK 1; ERK activator kinase 1; MAPK_ERK kinase 1; MEK1 Polyclonal 0.1 mg
18-662-20090 Dual specificity mitogen-activated protein kinase kinase 1 - EC 2.7.12.2; MAP kinase kinase 1; MAPKK 1; ERK activator kinase 1; MAPK_ERK kinase 1; MEK1 Polyclonal 0.1 ml
18-662-20091 Dual specificity mitogen-activated protein kinase kinase 1 - EC 2.7.12.2; MAP kinase kinase 1; MAPKK 1; ERK activator kinase 1; MAPK_ERK kinase 1; MEK1 Polyclonal 0.1 ml
10-782-55047 Dual specificity mitogen-activated protein kinase kinase 1 - EC 2.7.12.2; MAP kinase kinase 1; MAPKK 1; ERK activator kinase 1; MAPK_ERK kinase 1; MEK1 N_A 0.02 mg
10-782-55047 Dual specificity mitogen-activated protein kinase kinase 1 - EC 2.7.12.2; MAP kinase kinase 1; MAPKK 1; ERK activator kinase 1; MAPK_ERK kinase 1; MEK1 N_A 0.05 mg
10-782-55048 Dual specificity mitogen-activated protein kinase kinase 1 - EC 2.7.12.2; MAP kinase kinase 1; MAPKK 1; ERK activator kinase 1; MAPK_ERK kinase 1; MEK1 N_A 0.02 mg
10-782-55048 Dual specificity mitogen-activated protein kinase kinase 1 - EC 2.7.12.2; MAP kinase kinase 1; MAPKK 1; ERK activator kinase 1; MAPK_ERK kinase 1; MEK1 N_A 0.05 mg
EIAAB25228 Dual specificity mitogen-activated protein kinase kinase 1,ERK activator kinase 1,MAP kinase kinase 1,Map2k1,MAPK_ERK kinase 1,MAPKK 1,MEK 1,Mek1,Prkmk1,Rat,Rattus norvegicus
EIAAB25230 Dual specificity mitogen-activated protein kinase kinase 1,ERK activator kinase 1,MAP kinase kinase 1,Map2k1,MAPK_ERK kinase 1,MAPKK 1,MEK 1,Mek1,Mouse,Mus musculus,Prkmk1
EIAAB25229 Dual specificity mitogen-activated protein kinase kinase 1,ERK activator kinase 1,MAP kinase kinase 1,MAP2K1,MAPK_ERK kinase 1,MAPKK 1,MEK 1,MEK1,Oryctolagus cuniculus,PRKMK1,Rabbit
EIAAB25234 Dual specificity mitogen-activated protein kinase kinase 2,ERK activator kinase 2,MAP kinase kinase 2,Map2k2,MAPK_ERK kinase 2,MAPKK 2,MEK 2,Mek2,Mkk2,Prkmk2,Rat,Rattus norvegicus
EIAAB25236 Dual specificity mitogen-activated protein kinase kinase 2,ERK activator kinase 2,MAP kinase kinase 2,Map2k2,MAPK_ERK kinase 2,MAPKK 2,MEK 2,Mek2,Mkk2,Mouse,Mus musculus,Prkmk2
EIAAB25235 Dual specificity mitogen-activated protein kinase kinase 2,ERK activator kinase 2,Homo sapiens,Human,MAP kinase kinase 2,MAP2K2,MAPK_ERK kinase 2,MAPKK 2,MEK 2,MEK2,MKK2,PRKMK2
EIAAB25231 Dual specificity mitogen-activated protein kinase kinase 1,ERK activator kinase 1,Homo sapiens,Human,MAP kinase kinase 1,MAP2K1,MAPK_ERK kinase 1,MAPKK 1,MEK 1,MEK1,MKK1,PRKMK1
O51L1_HUMAN Rat ELISA Kit FOR Mps one binder kinase activator-like 1B 96T
E0259b Rat ELISA Kit FOR Mps one binder kinase activator-like 1B 96T
BLACE_HUMAN Rat ELISA Kit FOR Mps one binder kinase activator-like 1B 96T
pro-049 Recombinant Human MOB1, Mps One Binder Kinase Activator-Like 3 1mg
NPT2C_HUMAN Mouse ELISA Kit FOR Mps one binder kinase activator-like 2 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur