Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Macrophage scavenger receptor types I and II (Macrophage acetylated LDL receptor I and II) (Scavenger receptor class A member 1) (CD antigen CD204)

 MSRE_HUMAN              Reviewed;         451 AA.
P21757; D3DSP3; O60505; P21759; Q45F10;
01-MAY-1991, integrated into UniProtKB/Swiss-Prot.
01-MAY-1991, sequence version 1.
25-OCT-2017, entry version 180.
RecName: Full=Macrophage scavenger receptor types I and II;
AltName: Full=Macrophage acetylated LDL receptor I and II;
AltName: Full=Scavenger receptor class A member 1;
AltName: CD_antigen=CD204;
Name=MSR1; Synonyms=SCARA1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS I AND II), FUNCTION, AND TISSUE
SPECIFICITY.
PubMed=2251254; DOI=10.1073/pnas.87.23.9133;
Matsumoto A., Naito M., Itakura H., Ikemoto S., Asaoka H.,
Hayakawa I., Kanamori H., Aburatani H., Takaku F., Suzuki H.,
Kobari Y., Miyai T., Takahashi K., Cohen E.H., Wydro R., Housman D.E.,
Kodama T.;
"Human macrophage scavenger receptors: primary structure, expression,
and localization in atherosclerotic lesions.";
Proc. Natl. Acad. Sci. U.S.A. 87:9133-9137(1990).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM III), FUNCTION, AND TISSUE
SPECIFICITY.
PubMed=9548586;
Gough P.J., Greaves D.R., Gordon S.;
"A naturally occurring isoform of the human macrophage scavenger
receptor (SR-A) gene generated by alternative splicing blocks modified
LDL uptake.";
J. Lipid Res. 39:531-543(1998).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS CYS-23 AND ALA-275.
NIEHS SNPs program;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16421571; DOI=10.1038/nature04406;
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S.,
Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A.,
Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X.,
Allen N.R., Anderson S., Asakawa T., Blechschmidt K., Bloom T.,
Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K.,
DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G.,
Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B.,
Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P.,
Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H.,
Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C.,
O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K.,
Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R.,
Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K.,
Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q.,
Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N.,
Lander E.S.;
"DNA sequence and analysis of human chromosome 8.";
Nature 439:331-335(2006).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM I).
TISSUE=Testis;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 155-272.
PubMed=8093617;
Emi M., Asaoka H., Matsumoto A., Itakura H., Kurihara Y., Wada Y.,
Kanamori H., Yazaki Y., Takahashi E., Lepert M.;
"Structure, organization, and chromosomal mapping of the human
macrophage scavenger receptor gene.";
J. Biol. Chem. 268:2120-2125(1993).
[8]
DISULFIDE BONDS IN SRCR DOMAIN.
PubMed=8900177; DOI=10.1074/jbc.271.43.26924;
Resnick D., Chatterton J.E., Schwartz K., Slayter H., Krieger M.;
"Structures of class A macrophage scavenger receptors. Electron
microscopic study of flexible, multidomain, fibrous proteins and
determination of the disulfide bond pattern of the scavenger receptor
cysteine-rich domain.";
J. Biol. Chem. 271:26924-26930(1996).
[9]
POSSIBLE INVOLVEMENT IN PC, AND VARIANTS ALA-36; TYR-41; ALA-113;
TYR-174; ALA-275; SER-369 AND ARG-441.
PubMed=12244320; DOI=10.1038/ng994;
Xu J., Zheng S.L., Komiya A., Mychaleckyj J.C., Isaacs S.D., Hu J.J.,
Sterling D., Lange E.M., Hawkins G.A., Turner A., Ewing C.M.,
Faith D.A., Johnson J.R., Suzuki H., Bujnovszky P., Wiley K.E.,
DeMarzo A.M., Bova G.S., Chang B., Hall M.C., McCullough D.L.,
Partin A.W., Kassabian V.S., Carpten J.D., Bailey-Wilson J.E.,
Trent J.M., Ohar J., Bleecker E.R., Walsh P.C., Isaacs W.B.,
Meyers D.A.;
"Germline mutations and sequence variants of the macrophage scavenger
receptor 1 gene are associated with prostate cancer risk.";
Nat. Genet. 32:321-325(2002).
[10]
SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
PubMed=14759258; DOI=10.1186/gb-2004-5-2-r8;
Hillman R.T., Green R.E., Brenner S.E.;
"An unappreciated role for RNA surveillance.";
Genome Biol. 5:R8.1-R8.16(2004).
[11]
GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-221.
TISSUE=Liver;
PubMed=19159218; DOI=10.1021/pr8008012;
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
"Glycoproteomics analysis of human liver tissue by combination of
multiple enzyme digestion and hydrazide chemistry.";
J. Proteome Res. 8:651-661(2009).
[12]
INVOLVEMENT IN BE, AND VARIANT VAL-254.
PubMed=21791690; DOI=10.1001/jama.2011.1029;
Orloff M., Peterson C., He X., Ganapathi S., Heald B., Yang Y.R.,
Bebek G., Romigh T., Song J.H., Wu W., David S., Cheng Y.,
Meltzer S.J., Eng C.;
"Germline mutations in MSR1, ASCC1, and CTHRC1 in patients with
Barrett esophagus and esophageal adenocarcinoma.";
JAMA 306:410-419(2011).
[13]
INTERACTION WITH MYO18A.
PubMed=25965346; DOI=10.1371/journal.pone.0126576;
Yang L., Carrillo M., Wu Y.M., DiAngelo S.L., Silveyra P.,
Umstead T.M., Halstead E.S., Davies M.L., Hu S., Floros J.,
McCormack F.X., Christensen N.D., Chroneos Z.C.;
"SP-R210 (Myo18A) isoforms as intrinsic modulators of macrophage
priming and activation.";
PLoS ONE 10:E0126576-E0126576(2015).
-!- FUNCTION: Membrane glycoproteins implicated in the pathologic
deposition of cholesterol in arterial walls during atherogenesis.
Two types of receptor subunits exist. These receptors mediate the
endocytosis of a diverse group of macromolecules, including
modified low density lipoproteins (LDL) (PubMed:2251254). Isoform
III does not internalize acetylated LDL (PubMed:9548586).
{ECO:0000269|PubMed:2251254, ECO:0000269|PubMed:9548586}.
-!- SUBUNIT: Homotrimer (By similarity). Interacts with MYO18A
(PubMed:25965346). {ECO:0000250|UniProtKB:P30204,
ECO:0000269|PubMed:25965346}.
-!- INTERACTION:
P27449:ATP6V0C; NbExp=5; IntAct=EBI-1776976, EBI-721179;
Q86VS8:HOOK3; NbExp=4; IntAct=EBI-1776976, EBI-1777078;
Q7TQ77:Hook3 (xeno); NbExp=2; IntAct=EBI-1776976, EBI-1777000;
Q6FHL7:LEPROTL1; NbExp=3; IntAct=EBI-1776976, EBI-10249700;
Q13021:MALL; NbExp=5; IntAct=EBI-1776976, EBI-750078;
Q16617:NKG7; NbExp=5; IntAct=EBI-1776976, EBI-3919611;
Q96IW7:SEC22A; NbExp=5; IntAct=EBI-1776976, EBI-8652744;
-!- SUBCELLULAR LOCATION: Membrane; Single-pass type II membrane
protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=I;
IsoId=P21757-1; Sequence=Displayed;
Name=II;
IsoId=P21757-2; Sequence=VSP_006229, VSP_006230;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
Name=III;
IsoId=P21757-3; Sequence=VSP_036842;
-!- TISSUE SPECIFICITY: Isoform I, isoform II and isoform III are
expressed in monocyte-derived macrophages. Isoform I and isoform
II are expressed in the liver, placenta and brain.
{ECO:0000269|PubMed:2251254, ECO:0000269|PubMed:9548586}.
-!- DISEASE: Prostate cancer (PC) [MIM:176807]: A malignancy
originating in tissues of the prostate. Most prostate cancers are
adenocarcinomas that develop in the acini of the prostatic ducts.
Other rare histopathologic types of prostate cancer that occur in
approximately 5% of patients include small cell carcinoma,
mucinous carcinoma, prostatic ductal carcinoma, transitional cell
carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid
cystic carcinoma (basaloid), signet-ring cell carcinoma and
neuroendocrine carcinoma. {ECO:0000269|PubMed:12244320}. Note=The
disease may be caused by mutations affecting the gene represented
in this entry. MSR1 variants may play a role in susceptibility to
prostate cancer. MSR1 variants have been found in individuals with
prostate cancer and co-segregate with the disease in some
families.
-!- DISEASE: Barrett esophagus (BE) [MIM:614266]: A condition
characterized by a metaplastic change in which normal esophageal
squamous epithelium is replaced by a columnar and intestinal-type
epithelium. Patients with Barrett esophagus have an increased risk
of esophageal adenocarcinoma. The main cause of Barrett esophagus
is gastroesophageal reflux. The retrograde movement of acid and
bile salts from the stomach into the esophagus causes prolonged
injury to the esophageal epithelium and induces chronic
esophagitis, which in turn is believed to trigger the pathologic
changes. {ECO:0000269|PubMed:21791690}. Note=The disease may be
caused by mutations affecting the gene represented in this entry.
Genetic variants in MSR1 have been found in individuals with
Barrett esophagus and are thought to contribute to disease
susceptibility.
-!- WEB RESOURCE: Name=NIEHS-SNPs;
URL="http://egp.gs.washington.edu/data/msr1/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; D90187; BAA14208.1; -; mRNA.
EMBL; D90188; BAA14209.1; -; mRNA.
EMBL; AF037351; AAC09251.1; -; mRNA.
EMBL; DQ144993; AAZ38715.1; -; Genomic_DNA.
EMBL; AC023396; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471080; EAW63832.1; -; Genomic_DNA.
EMBL; CH471080; EAW63830.1; -; Genomic_DNA.
EMBL; CH471080; EAW63833.1; -; Genomic_DNA.
EMBL; CH471080; EAW63834.1; -; Genomic_DNA.
EMBL; BC063878; AAH63878.1; -; mRNA.
EMBL; D13263; -; NOT_ANNOTATED_CDS; Genomic_DNA.
CCDS; CCDS5995.1; -. [P21757-1]
CCDS; CCDS5996.1; -. [P21757-3]
CCDS; CCDS5997.1; -. [P21757-2]
PIR; A38415; A38415.
PIR; B38415; B38415.
RefSeq; NP_002436.1; NM_002445.3. [P21757-2]
RefSeq; NP_619729.1; NM_138715.2. [P21757-1]
RefSeq; NP_619730.1; NM_138716.2. [P21757-3]
UniGene; Hs.147635; -.
ProteinModelPortal; P21757; -.
SMR; P21757; -.
BioGrid; 110587; 11.
IntAct; P21757; 10.
STRING; 9606.ENSP00000262101; -.
BindingDB; P21757; -.
ChEMBL; CHEMBL5811; -.
iPTMnet; P21757; -.
PhosphoSitePlus; P21757; -.
BioMuta; MSR1; -.
DMDM; 127357; -.
PaxDb; P21757; -.
PeptideAtlas; P21757; -.
PRIDE; P21757; -.
DNASU; 4481; -.
Ensembl; ENST00000262101; ENSP00000262101; ENSG00000038945. [P21757-1]
Ensembl; ENST00000350896; ENSP00000262100; ENSG00000038945. [P21757-3]
Ensembl; ENST00000355282; ENSP00000347430; ENSG00000038945. [P21757-3]
Ensembl; ENST00000381998; ENSP00000371428; ENSG00000038945. [P21757-2]
GeneID; 4481; -.
KEGG; hsa:4481; -.
UCSC; uc003wwz.4; human. [P21757-1]
CTD; 4481; -.
DisGeNET; 4481; -.
EuPathDB; HostDB:ENSG00000038945.14; -.
GeneCards; MSR1; -.
HGNC; HGNC:7376; MSR1.
HPA; CAB032491; -.
HPA; HPA000272; -.
MalaCards; MSR1; -.
MIM; 153622; gene.
MIM; 176807; phenotype.
MIM; 614266; phenotype.
neXtProt; NX_P21757; -.
OpenTargets; ENSG00000038945; -.
Orphanet; 1232; Barrett esophagus.
Orphanet; 1331; Familial prostate cancer.
PharmGKB; PA31181; -.
eggNOG; ENOG410IK8A; Eukaryota.
eggNOG; ENOG410YQBT; LUCA.
GeneTree; ENSGT00900000140830; -.
HOGENOM; HOG000085659; -.
HOVERGEN; HBG002473; -.
InParanoid; P21757; -.
KO; K06558; -.
PhylomeDB; P21757; -.
TreeFam; TF330855; -.
Reactome; R-HSA-3000480; Scavenging by Class A Receptors.
SIGNOR; P21757; -.
GeneWiki; MSR1; -.
GenomeRNAi; 4481; -.
PRO; PR:P21757; -.
Proteomes; UP000005640; Chromosome 8.
Bgee; ENSG00000038945; -.
CleanEx; HS_MSR1; -.
ExpressionAtlas; P21757; baseline and differential.
Genevisible; P21757; HS.
GO; GO:0005581; C:collagen trimer; IEA:UniProtKB-KW.
GO; GO:0005829; C:cytosol; IEA:Ensembl.
GO; GO:0030666; C:endocytic vesicle membrane; TAS:Reactome.
GO; GO:0005887; C:integral component of plasma membrane; TAS:ProtInc.
GO; GO:0034362; C:low-density lipoprotein particle; IEA:UniProtKB-KW.
GO; GO:0005886; C:plasma membrane; ISS:ARUK-UCL.
GO; GO:0001540; F:amyloid-beta binding; IEA:Ensembl.
GO; GO:0030169; F:low-density lipoprotein particle binding; ISS:BHF-UCL.
GO; GO:0005044; F:scavenger receptor activity; TAS:ARUK-UCL.
GO; GO:0097242; P:amyloid-beta clearance; ISS:ARUK-UCL.
GO; GO:0071407; P:cellular response to organic cyclic compound; IEA:Ensembl.
GO; GO:0030301; P:cholesterol transport; ISS:BHF-UCL.
GO; GO:0042953; P:lipoprotein transport; IEA:Ensembl.
GO; GO:0010629; P:negative regulation of gene expression; ISS:ARUK-UCL.
GO; GO:0006911; P:phagocytosis, engulfment; ISS:ARUK-UCL.
GO; GO:0034381; P:plasma lipoprotein particle clearance; ISS:BHF-UCL.
GO; GO:0010886; P:positive regulation of cholesterol storage; ISS:BHF-UCL.
GO; GO:0010744; P:positive regulation of macrophage derived foam cell differentiation; ISS:BHF-UCL.
GO; GO:0006898; P:receptor-mediated endocytosis; TAS:Reactome.
Gene3D; 2.160.20.50; -; 1.
InterPro; IPR008160; Collagen.
InterPro; IPR016133; Insect_cyst_antifreeze_prot.
InterPro; IPR003543; Macro_scav_rcpt.
InterPro; IPR001190; SRCR.
InterPro; IPR017448; SRCR-like_dom.
InterPro; IPR036772; SRCR-like_dom_sf.
Pfam; PF01391; Collagen; 1.
Pfam; PF03523; Macscav_rec; 1.
Pfam; PF00530; SRCR; 1.
PRINTS; PR01408; MACSCAVRCPTR.
PRINTS; PR00258; SPERACTRCPTR.
SMART; SM00202; SR; 1.
SUPFAM; SSF56487; SSF56487; 1.
PROSITE; PS00420; SRCR_1; 1.
PROSITE; PS50287; SRCR_2; 1.
1: Evidence at protein level;
Alternative splicing; Coiled coil; Collagen; Complete proteome;
Disulfide bond; Endocytosis; Glycoprotein; LDL; Membrane;
Phosphoprotein; Polymorphism; Receptor; Reference proteome;
Signal-anchor; Transmembrane; Transmembrane helix.
CHAIN 1 451 Macrophage scavenger receptor types I and
II.
/FTId=PRO_0000181627.
TOPO_DOM 1 50 Cytoplasmic. {ECO:0000255}.
TRANSMEM 51 76 Helical; Signal-anchor for type II
membrane protein. {ECO:0000255}.
TOPO_DOM 77 451 Extracellular. {ECO:0000255}.
DOMAIN 273 341 Collagen-like.
DOMAIN 350 450 SRCR. {ECO:0000255|PROSITE-
ProRule:PRU00196}.
REGION 77 109 Spacer. {ECO:0000305}.
COILED 171 255 {ECO:0000255}.
MOD_RES 27 27 Phosphoserine.
{ECO:0000250|UniProtKB:P30204}.
CARBOHYD 82 82 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 102 102 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 143 143 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 184 184 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 221 221 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:19159218}.
CARBOHYD 249 249 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 267 267 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 375 439 {ECO:0000255|PROSITE-ProRule:PRU00196,
ECO:0000269|PubMed:8900177}.
DISULFID 388 449 {ECO:0000255|PROSITE-ProRule:PRU00196,
ECO:0000269|PubMed:8900177}.
DISULFID 419 429 {ECO:0000255|PROSITE-ProRule:PRU00196,
ECO:0000269|PubMed:8900177}.
VAR_SEQ 345 408 TPFTKVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQ
VVCRSLGYPGVQAVHKAAHFGQG -> S (in isoform
III). {ECO:0000303|PubMed:9548586}.
/FTId=VSP_036842.
VAR_SEQ 345 358 TPFTKVRLVGGSGP -> RPVQLTDHIRAGPS (in
isoform II).
{ECO:0000303|PubMed:2251254}.
/FTId=VSP_006229.
VAR_SEQ 359 451 Missing (in isoform II).
{ECO:0000303|PubMed:2251254}.
/FTId=VSP_006230.
VARIANT 23 23 F -> C (in dbSNP:rs35175081).
{ECO:0000269|Ref.3}.
/FTId=VAR_025190.
VARIANT 36 36 P -> A (found in a family with prostate
cancer; dbSNP:rs749666450).
{ECO:0000269|PubMed:12244320}.
/FTId=VAR_066581.
VARIANT 41 41 S -> Y (found in patients with prostate
cancer; dbSNP:rs145597376).
{ECO:0000269|PubMed:12244320}.
/FTId=VAR_066582.
VARIANT 113 113 V -> A (found in patients with prostate
cancer; dbSNP:rs117359034).
{ECO:0000269|PubMed:12244320}.
/FTId=VAR_066583.
VARIANT 174 174 D -> Y (found in patients with prostate
cancer; dbSNP:rs72552387).
{ECO:0000269|PubMed:12244320}.
/FTId=VAR_066584.
VARIANT 254 254 L -> V (found in patients with Barrett
esophagus; dbSNP:rs387906645).
{ECO:0000269|PubMed:21791690}.
/FTId=VAR_066585.
VARIANT 269 269 T -> I (in dbSNP:rs13306543).
/FTId=VAR_052061.
VARIANT 275 275 P -> A (in dbSNP:rs3747531).
{ECO:0000269|PubMed:12244320,
ECO:0000269|Ref.3}.
/FTId=VAR_025191.
VARIANT 369 369 G -> S (found in a family with prostate
cancer; dbSNP:rs776370129).
{ECO:0000269|PubMed:12244320}.
/FTId=VAR_066586.
VARIANT 441 441 H -> R (found in patients with prostate
cancer; dbSNP:rs138749399).
{ECO:0000269|PubMed:12244320}.
/FTId=VAR_066587.
SEQUENCE 451 AA; 49762 MW; 915C03B56653BB41 CRC64;
MEQWDHFHNQ QEDTDSCSES VKFDARSMTA LLPPNPKNSP SLQEKLKSFK AALIALYLLV
FAVLIPLIGI VAAQLLKWET KNCSVSSTNA NDITQSLTGK GNDSEEEMRF QEVFMEHMSN
MEKRIQHILD MEANLMDTEH FQNFSMTTDQ RFNDILLQLS TLFSSVQGHG NAIDEISKSL
ISLNTTLLDL QLNIENLNGK IQENTFKQQE EISKLEERVY NVSAEIMAMK EEQVHLEQEI
KGEVKVLNNI TNDLRLKDWE HSQTLRNITL IQGPPGPPGE KGDRGPTGES GPRGFPGPIG
PPGLKGDRGA IGFPGSRGLP GYAGRPGNSG PKGQKGEKGS GNTLTPFTKV RLVGGSGPHE
GRVEILHSGQ WGTICDDRWE VRVGQVVCRS LGYPGVQAVH KAAHFGQGTG PIWLNEVFCF
GRESSIEECK IRQWGTRACS HSEDAGVTCT L


Related products :

Catalog number Product name Quantity
EIAAB25543 Homo sapiens,Human,Macrophage acetylated LDL receptor I and II,Macrophage scavenger receptor types I and II,MSR1,SCARA1,Scavenger receptor class A member 1
EIAAB25544 Macrophage acetylated LDL receptor I and II,Macrophage scavenger receptor types I and II,Mouse,Msr1,Mus musculus,Scavenger receptor type A,Scvr,SR-A
EIAAB25542 Macrophage acetylated LDL receptor I and II,Macrophage scavenger receptor types I and II,MSR1,Oryctolagus cuniculus,Rabbit
EIAAB25541 Bos taurus,Bovine,Macrophage acetylated LDL receptor I and II,Macrophage scavenger receptor types I and II,MSR1
YSRTMCA1322GA CD204, Macrophage Scavenger Receptor, Types I & II, Clone 2F8, Rat Mab anti_Mouse 0.1 mg.
YSRTMCA1322PE CD204, Macrophage Scavenger Receptor, Types I & II, Clone 2F8, Rat Mab anti_Mouse, PE; flow vial
YSRTMCA1322EL CD204, Macrophage Scavenger Receptor, Types I & II, Clone 2F8, Rat Mab anti_Mouse, endotoxin low 0.5 mg.
YSRTMCA1322B CD204, Macrophage Scavenger Receptor, Types I & II, Clone 2F8, Rat Mab anti_Mouse, Biotin 0.1 mg.
YSRTMCA1322 CD204, Macrophage Scavenger Receptor, Types I & II, Clone 2F8, Rat Mab anti_Mouse; frozen, IH_flow_ELISA_IP_WB 0.25 mg.
YSRTMCA1322FB CD204, Macrophage Scavenger Receptor, Types I & II, Clone 2F8, Rat Mab anti_Mouse, FITC; flow 0.5 mg.
YSRTMCA1322F CD204, Macrophage Scavenger Receptor, Types I & II, Clone 2F8, Rat Mab anti_Mouse, FITC; flow 0.1 mg.
YSRTMCA1322A488 CD204, Macrophage Scavenger Receptor, Types I & II, Clone 2F8, Rat Mab anti_Mouse, ALEXA 488 conj. vial
YSRTMCA1322A647 CD204, Macrophage Scavenger Receptor, Types I & II, Clone 2F8, Rat Mab anti_Mouse, ALEXA 647 conj. vial
BMA2F8 Mouse Macrophage Scavenger Receptor, Types I & II, CD204, Clone 2F8, Rat Mab anti_, Inhibits uptake & adhesion_IHC_FACS 250 µg.
EIAAB08534 CLP1,CL-P1,COLEC12,Collectin placenta protein 1,Collectin-12,hCL-P1,Homo sapiens,Human,NSR2,Nurse cell scavenger receptor 2,SCARA4,Scavenger receptor class A member 4,Scavenger receptor with C-type le
KT022 Anti Human Class A Macrophage Scavenger Receptor (MSR_A CD204) Monoclonal Antibody ( Clone No.SRA_E5 ) 0.25
EIAAB37524 Homo sapiens,Human,SCARA5,Scavenger receptor class A member 5,Scavenger receptor hlg,UNQ2938_PRO28700
EIAAB39868 Acetyl LDL receptor,Kiaa0149,Mouse,Mus musculus,Scarf1,Scavenger receptor class F member 1,Scavenger receptor expressed by endothelial cells 1 protein,Srec,SREC-I
EIAAB39869 Acetyl LDL receptor,Homo sapiens,Human,KIAA0149,SCARF1,Scavenger receptor class F member 1,Scavenger receptor expressed by endothelial cells 1,SREC,SREC-I
EIAAB39870 Mouse,Mus musculus,Scarf2,Scavenger receptor class F member 2,Scavenger receptor expressed by endothelial cells 2 protein,Srec2,SREC-II
RA25074-100 Macrophage Scavenger Receptor I-CD204, affinity purified antibody, rabbit, 100 ul.
RA25074-100 Macrophage Scavenger Receptor I per CD204, affinity purified antibody, rabbit, 100 ul.
EIAAB39871 Homo sapiens,Human,SCARF2,Scavenger receptor class F member 2,Scavenger receptor expressed by endothelial cells 2 protein,SREC2,SREC-II,SRECRP-1,SREPCR
CSB-EL015050HU Human Macrophage scavenger receptor types I and II(MSR1) ELISA kit 96T
CSB-EL015050BO Bovine Macrophage scavenger receptor types I and II(MSR1) ELISA kit 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur