Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Mediator of RNA polymerase II transcription subunit 13 (Protein GRAND CENTRAL) (Protein MACCHI-BOU 2)

 MED13_ARATH             Reviewed;        1921 AA.
F4I096; F4I095; Q9C8A3;
22-FEB-2012, integrated into UniProtKB/Swiss-Prot.
28-JUN-2011, sequence version 1.
10-OCT-2018, entry version 43.
RecName: Full=Mediator of RNA polymerase II transcription subunit 13;
AltName: Full=Protein GRAND CENTRAL;
AltName: Full=Protein MACCHI-BOU 2;
Name=MED13; Synonyms=GCT, MAB2, MED13_1; OrderedLocusNames=At1g55325;
ORFNames=F7A10.14;
Arabidopsis thaliana (Mouse-ear cress).
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae;
Arabidopsis.
NCBI_TaxID=3702;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=cv. Columbia;
PubMed=11130712; DOI=10.1038/35048500;
Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S.,
White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y.,
Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W.,
Chung M.K., Conn L., Conway A.B., Conway A.R., Creasy T.H., Dewar K.,
Dunn P., Etgu P., Feldblyum T.V., Feng J.-D., Fong B., Fujii C.Y.,
Gill J.E., Goldsmith A.D., Haas B., Hansen N.F., Hughes B., Huizar L.,
Hunter J.L., Jenkins J., Johnson-Hopson C., Khan S., Khaykin E.,
Kim C.J., Koo H.L., Kremenetskaia I., Kurtz D.B., Kwan A., Lam B.,
Langin-Hooper S., Lee A., Lee J.M., Lenz C.A., Li J.H., Li Y.-P.,
Lin X., Liu S.X., Liu Z.A., Luros J.S., Maiti R., Marziali A.,
Militscher J., Miranda M., Nguyen M., Nierman W.C., Osborne B.I.,
Pai G., Peterson J., Pham P.K., Rizzo M., Rooney T., Rowley D.,
Sakano H., Salzberg S.L., Schwartz J.R., Shinn P., Southwick A.M.,
Sun H., Tallon L.J., Tambunga G., Toriumi M.J., Town C.D.,
Utterback T., Van Aken S., Vaysberg M., Vysotskaia V.S., Walker M.,
Wu D., Yu G., Fraser C.M., Venter J.C., Davis R.W.;
"Sequence and analysis of chromosome 1 of the plant Arabidopsis
thaliana.";
Nature 408:816-820(2000).
[2]
GENOME REANNOTATION.
STRAIN=cv. Columbia;
PubMed=27862469; DOI=10.1111/tpj.13415;
Cheng C.Y., Krishnakumar V., Chan A.P., Thibaud-Nissen F., Schobel S.,
Town C.D.;
"Araport11: a complete reannotation of the Arabidopsis thaliana
reference genome.";
Plant J. 89:789-804(2017).
[3]
UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-220 AND LYS-226, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
STRAIN=cv. Landsberg erecta;
PubMed=17272265; DOI=10.1074/mcp.M600408-MCP200;
Maor R., Jones A., Nuehse T.S., Studholme D.J., Peck S.C., Shirasu K.;
"Multidimensional protein identification technology (MudPIT) analysis
of ubiquitinated proteins in plants.";
Mol. Cell. Proteomics 6:601-610(2007).
[4]
FUNCTION, MUTAGENESIS OF SER-407, DEVELOPMENTAL STAGE, TISSUE
SPECIFICITY, AND DISRUPTION PHENOTYPE.
PubMed=20023166; DOI=10.1242/dev.043174;
Gillmor C.S., Park M.Y., Smith M.R., Pepitone R., Kerstetter R.A.,
Poethig R.S.;
"The MED12-MED13 module of Mediator regulates the timing of embryo
patterning in Arabidopsis.";
Development 137:113-122(2010).
[5]
FUNCTION, SUBUNIT, AND DISRUPTION PHENOTYPE.
PubMed=21257604; DOI=10.1093/pcp/pcr013;
Ito J., Sono T., Tasaka M., Furutani M.;
"MACCHI-BOU 2 is required for early embryo patterning and cotyledon
organogenesis in Arabidopsis.";
Plant Cell Physiol. 52:539-552(2011).
[6]
IDENTIFICATION, SUBUNIT, AND NOMENCLATURE.
PubMed=22021418; DOI=10.1104/pp.111.188300;
Mathur S., Vyas S., Kapoor S., Tyagi A.K.;
"The Mediator complex in plants: structure, phylogeny, and expression
profiling of representative genes in a dicot (Arabidopsis) and a
monocot (rice) during reproduction and abiotic stress.";
Plant Physiol. 157:1609-1627(2011).
[7]
FUNCTION, AND DISRUPTION PHENOTYPE.
PubMed=22247249; DOI=10.1093/pcp/pcs002;
Imura Y., Kobayashi Y., Yamamoto S., Furutani M., Tasaka M., Abe M.,
Araki T.;
"CRYPTIC PRECOCIOUS/MED12 is a novel flowering regulator with multiple
target steps in Arabidopsis.";
Plant Cell Physiol. 53:287-303(2012).
-!- FUNCTION: Component of the Mediator complex, a coactivator
involved in the regulated transcription of nearly all RNA
polymerase II-dependent genes. Mediator functions as a bridge to
convey information from gene-specific regulatory proteins to the
basal RNA polymerase II transcription machinery. The Mediator
complex, having a compact conformation in its free form, is
recruited to promoters by direct interactions with regulatory
proteins and serves for the assembly of a functional preinitiation
complex with RNA polymerase II and the general transcription
factors. Acts closely together with MAB12. Involved in the
regulation of embryo patterning and cotyledon organogenesis. May
act through transient repression of specific genes such as the
ones responsive to auxin. {ECO:0000269|PubMed:20023166,
ECO:0000269|PubMed:21257604, ECO:0000269|PubMed:22247249}.
-!- SUBUNIT: Component of the Mediator complex. Interacts with CYCC1-2
(CDK8 homolog). {ECO:0000269|PubMed:21257604,
ECO:0000269|PubMed:22021418}.
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Comment=A number of isoforms are produced. According to EST
sequences.;
Name=1;
IsoId=F4I096-1; Sequence=Displayed;
Name=2;
IsoId=F4I096-2; Sequence=VSP_043977, VSP_043978, VSP_043979,
VSP_043980, VSP_043981, VSP_043982;
-!- TISSUE SPECIFICITY: Ubiquitous. Highest expression in the shoot
apex. {ECO:0000269|PubMed:20023166}.
-!- DEVELOPMENTAL STAGE: Expressed in both the apical and basal cell
at the one-cell embryo stage and in all cells of the embryo and
suspensor through the globular stage. Decreases in the periphery
of the hypocotyl and on the abaxial side of cotyledons from the
heart stage to the torpedo stage, and by the bent cotyledon stage,
restricted to the vascular tissue and the shoot and root apical
meristems. {ECO:0000269|PubMed:20023166}.
-!- DISRUPTION PHENOTYPE: Abnormal embryo and cotyledon development,
and embryo lethality in most cases. When viable, plants are small
with greatly delayed flowering time and sterile flowers.
{ECO:0000269|PubMed:20023166, ECO:0000269|PubMed:21257604,
ECO:0000269|PubMed:22247249}.
-!- SIMILARITY: Belongs to the Mediator complex subunit 13 family.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAG51574.1; Type=Erroneous gene model prediction; Note=The predicted gene At1g55325 has been split into 2 genes: At1g55320 and At1g55325.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AC027034; AAG51574.1; ALT_SEQ; Genomic_DNA.
EMBL; CP002684; AEE33227.1; -; Genomic_DNA.
EMBL; CP002684; AEE33228.1; -; Genomic_DNA.
PIR; D96595; D96595.
RefSeq; NP_001185237.1; NM_001198308.1. [F4I096-2]
RefSeq; NP_849809.2; NM_179478.2. [F4I096-1]
UniGene; At.46071; -.
ProteinModelPortal; F4I096; -.
SMR; F4I096; -.
BioGrid; 27203; 1.
iPTMnet; F4I096; -.
PRIDE; F4I096; -.
EnsemblPlants; AT1G55325.1; AT1G55325.1; AT1G55325. [F4I096-1]
EnsemblPlants; AT1G55325.2; AT1G55325.2; AT1G55325. [F4I096-2]
GeneID; 841978; -.
Gramene; AT1G55325.1; AT1G55325.1; AT1G55325. [F4I096-1]
Gramene; AT1G55325.2; AT1G55325.2; AT1G55325. [F4I096-2]
KEGG; ath:AT1G55325; -.
Araport; AT1G55325; -.
TAIR; locus:1005716738; AT1G55325.
InParanoid; F4I096; -.
KO; K15164; -.
OMA; MFNAGYF; -.
PRO; PR:F4I096; -.
Proteomes; UP000006548; Chromosome 1.
ExpressionAtlas; F4I096; baseline and differential.
Genevisible; F4I096; AT.
GO; GO:0016021; C:integral component of membrane; IBA:GO_Central.
GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell.
GO; GO:0051119; F:sugar transmembrane transporter activity; IBA:GO_Central.
GO; GO:0008643; P:carbohydrate transport; IBA:GO_Central.
GO; GO:0007275; P:multicellular organism development; IEA:UniProtKB-KW.
GO; GO:0040034; P:regulation of development, heterochronic; IMP:TAIR.
GO; GO:0040008; P:regulation of growth; IEA:UniProtKB-KW.
GO; GO:0090213; P:regulation of radial pattern formation; IMP:TAIR.
GO; GO:0006355; P:regulation of transcription, DNA-templated; IEA:UniProtKB-KW.
GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Developmental protein;
Growth regulation; Isopeptide bond; Nucleus; Reference proteome;
Repressor; Transcription; Transcription regulation; Ubl conjugation.
CHAIN 1 1921 Mediator of RNA polymerase II
transcription subunit 13.
/FTId=PRO_0000415734.
COMPBIAS 407 426 Ser-rich.
COMPBIAS 486 495 Poly-Asp.
CROSSLNK 220 220 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in ubiquitin).
{ECO:0000244|PubMed:17272265}.
CROSSLNK 226 226 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in ubiquitin).
{ECO:0000244|PubMed:17272265}.
VAR_SEQ 216 245 Missing (in isoform 2). {ECO:0000305}.
/FTId=VSP_043977.
VAR_SEQ 382 382 R -> RFWLQNWIGPSLAGSSLFMHW (in isoform
2). {ECO:0000305}.
/FTId=VSP_043978.
VAR_SEQ 1037 1056 Missing (in isoform 2). {ECO:0000305}.
/FTId=VSP_043979.
VAR_SEQ 1152 1171 GESTSLSFVKEVMLKHDRNW -> VYETCR (in
isoform 2). {ECO:0000305}.
/FTId=VSP_043980.
VAR_SEQ 1559 1559 R -> RGELLDTHIFPFGGISSRQDTKGLQCLFVQ (in
isoform 2). {ECO:0000305}.
/FTId=VSP_043981.
VAR_SEQ 1921 1921 V -> LKVLTTDSGSQSLSMSLPRDHLDGICFQHTDCNFLR
CCSPFLSGHIRRDGEQVNGQIKTAAIYYGVSLFPGKIDNLN
AMVWSHSCCRPLSSMHHMA (in isoform 2).
{ECO:0000305}.
/FTId=VSP_043982.
MUTAGEN 407 407 S->N: In gct-3; uncoupled cell division,
pattern formation and morphogenesis
during embryogenesis.
{ECO:0000269|PubMed:20023166}.
SEQUENCE 1921 AA; 208462 MW; 65425954D40C7C88 CRC64;
MWTNVFRIGG LHNVSWFQFL PSETELNPGF DRSSRAEQNE VATYLVLSSH LRLQKEGFLT
TWTNSFVGPW DPSQGLYNPD EKIKLWLFLP GRHSSISDKA QAAVSKLRVV ASGIWVAPGD
SEEISVAFSQ SLRNCIERAL SGISYMRFGD VFSKFSPQSE EYLRRGQPTV EFIFAATEEA
VFVHVIISAK NVRTLSSGDA ERMLRSSLKN SSYRLPAFRK CLGLAKSEDN RLCYINTSHR
PMLFPPVIVS PHGMRGSLTG FCPNDLVKQV YFSSGNLKTS TGYVGLPSHI GRGSRLINGN
HCYVEVTLGC CQNRNDNTSQ ANSTFAVNLP HNQCPEPSVG SKDHRKGQSD LSSVCEKKFI
YPAEAVLVPI LQSAFAKFSL KRAGDFDCLG ASENKSDGFY EKNGYNSSGS SRNSSISSTS
SASSGSGWRM TSRTGDLDAD ADSLTCRQSG LTCNDDRLKM GSKRPRTGMA ESFGQVGIEN
DQIGWDWDAD DDDDDREVGM DIKALLSEFG DFGDFFENDA LPFGEPPGTA ESHVLVFPPD
SADVGSSPVD MMDVSDQIVL PVGFSSFESF NPVPPIIDEC LIKSQEVLHS SITSVPSNQM
SISSTGEFDH LLKAEAMMTF APEYGAVEAP MSEISSTFFK SPYLPKSHKV ESSNSRTSNY
VYGATPPTTD SDGAGDMILF GSKSCIGNNA GRTLYHSREH YTQVEGRKGR HDKLPTVISD
NSSTKEGVSQ SIHSKHSAAN AVKVVQGKKT DGISAVVSTL LSSKTLLATD VGSVMFQAFM
CRMRHIITSS KHSSPVSLTR LSGNFFLNQL SNEPSTLTDN ISARNEIYKK DIPTRIAGDF
DGGMLDSHMS APVGVWRTVS VPKTAKPASS PNIEAGSSLP HSSFSEDSLL SYGQRQPLQD
LLDGIALLVQ QATSFVDLAL DSDCGDGPYG WLALEELWRR ELSCGPSAGH AGCGGTLASC
HSLDIAGVKL VDPLSAEVFP SSVITLLQSD IKTALKSAFG QSDGPLSVTD WCKGRNQSGD
GGSISEGFTA ESALSEVNGV NISDDFIIDK YFGKQAVSNA IDGGKGDETA QSQDIYSSEL
LRPTLFVLPS PAILVGYQDD WLKISTNSLT HWEKAPFEPY ALPKSINYAV VCPDIDPLTC
AATDFFQQLG TGESTSLSFV KEVMLKHDRN WLGTHLPQSL GNQMEKDVGR LSSSGFVLLD
CPQSMKIESN NTSLLGSLSD YFLSLSNGWN VNSYLKSLSK ALKGLKLGSG LYTNQKEGSG
SPCVVVYIVC PFPDPSAVLR TIVESSIALG SVIQSDRDRR SILNSQVARA FSSSTAVDEA
SISHIPVLSG FSVPKLVLQV VSVDSIFRIT SPSFNELVIL KDTAFSVYNK ARRISRGMPN
DAFFSSSLPS RSSSALTPMN SISGIWKDCG GSRMTGSTHP RDGEIDVSLR TSGWDTSTSW
QIPRSGGLSC DPNRNGDFYL NDEIFYLFEP LFILSEPGSV ERGVSPTFTS LGSESSKPIP
EDGGRGSGPG MNSMEGITSG SSSQGDVSQL EGKAIPSLHC CYGWTEDWRW LVSIWTDARV
LQQGCQILQA CSSPDNGSFK PRDFVITRIG NFFELEYQEW QKAIYSAGGP EIKKWPIQLR
RSAPSGIATN SNGSSLQQQD LSLIQERASS TSTLYSSHSK QSTFVKGSMG QSAGRKQIMG
GQTISGTPRG LFQWVHSISF ASISLDHSLH FVLPAELVSA GGGQSSTGMS SVNYIEGFTP
VKSLGSTAFS YMMIPSPNMR FLHPSPLQLP TCLTAESPPL AHLLHSKGYA IPLSTGFVVS
KAVPSMRKDS RINVKEEWPS VLSVSLIDYY GGYDNAHDKI LQGIVKQGGG TKETRDFEVE
SHLILESIAA ELHALSWMTV SPAYLDRRTA LPFHCDMVLR LRRLLHFADK EVSRIPDKTG
V


Related products :

Catalog number Product name Quantity
EIAAB06530 CDK8,Cell division protein kinase 8,Cyclin-dependent kinase 8,Homo sapiens,Human,Mediator complex subunit CDK8,Mediator of RNA polymerase II transcription subunit CDK8,Protein kinase K35
EIAAB06531 Cdk8,Cell division protein kinase 8,Cyclin-dependent kinase 8,Mediator complex subunit CDK8,Mediator of RNA polymerase II transcription subunit CDK8,Mouse,Mus musculus
E0667m Human ELISA Kit FOR Mediator of RNA polymerase II transcription subunit 12-like protein 96T
SO2A1_MOUSE Human ELISA Kit FOR Mediator of RNA polymerase II transcription subunit 12-like protein 96T
CSB-EL013644MO Mouse Mediator of RNA polymerase II transcription subunit 12-like protein(MED12L) ELISA kit 96T
CSB-EL013644HU Human Mediator of RNA polymerase II transcription subunit 12-like protein(MED12L) ELISA kit 96T
CSB-EL013644HU Human Mediator of RNA polymerase II transcription subunit 12-like protein(MED12L) ELISA kit SpeciesHuman 96T
CSB-EL013644MO Mouse Mediator of RNA polymerase II transcription subunit 12-like protein(MED12L) ELISA kit SpeciesMouse 96T
MD12L_MOUSE ELISA Kit FOR Mediator of RNA polymerase II transcription subunit 12-like protein; organism: Mouse; gene name: Med12l 96T
28-735 MED21 belongs to the Mediator complex subunit 21 family. It is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent ge 0.05 mg
4731 Mediator of RNA polymerase II transcription subunit 28 0.1 mg
4729 Mediator of RNA polymerase II transcription subunit 4 0.5 mg
4731 Mediator of RNA polymerase II transcription subunit 28 0.5 mg
4729 Mediator of RNA polymerase II transcription subunit 4 0.1 mg
EH1315 Mediator of RNA polymerase II transcription subunit 31 Elisa Kit 96T
CSB-EL013665RA Rat Mediator of RNA polymerase II transcription subunit 4(MED4) ELISA kit 96T
E14942h Human ELISA Kit FOR Mediator of RNA polymerase II transcription subunit 19 96T
E0633m Human ELISA Kit FOR Mediator of RNA polymerase II transcription subunit 26 96T
E0257c Mouse ELISA Kit FOR Mediator of RNA polymerase II transcription subunit 4 96T
TBC12_HUMAN Mouse ELISA Kit FOR Mediator of RNA polymerase II transcription subunit 6 96T
CSB-EL013656RA Rat Mediator of RNA polymerase II transcription subunit 23(MED23) ELISA kit 96T
E0209m Mouse ELISA Kit FOR Mediator of RNA polymerase II transcription subunit 19 96T
CSB-EL013653RA Rat Mediator of RNA polymerase II transcription subunit 20(MED20) ELISA kit 96T
CSB-EL013661RA Rat Mediator of RNA polymerase II transcription subunit 28(MED28) ELISA kit 96T
CSB-EL013655RA Rat Mediator of RNA polymerase II transcription subunit 22(MED22) ELISA kit 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur