Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Mediator of RNA polymerase II transcription subunit 16 (Mediator complex subunit 16) (Thyroid hormone receptor-associated protein 5) (Thyroid hormone receptor-associated protein complex 95 kDa component) (Trap95) (Vitamin D3 receptor-interacting protein complex 92 kDa component) (DRIP92)

 MED16_HUMAN             Reviewed;         877 AA.
Q9Y2X0; Q6PJT2; Q96AD4; Q96I35; Q9Y652;
12-APR-2005, integrated into UniProtKB/Swiss-Prot.
12-APR-2005, sequence version 2.
23-MAY-2018, entry version 142.
RecName: Full=Mediator of RNA polymerase II transcription subunit 16;
AltName: Full=Mediator complex subunit 16;
AltName: Full=Thyroid hormone receptor-associated protein 5;
AltName: Full=Thyroid hormone receptor-associated protein complex 95 kDa component;
Short=Trap95;
AltName: Full=Vitamin D3 receptor-interacting protein complex 92 kDa component;
Short=DRIP92;
Name=MED16; Synonyms=DRIP92 {ECO:0000312|EMBL:AAD31087.1}, THRAP5;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1] {ECO:0000305, ECO:0000312|EMBL:AAD30032.1}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 277-283,
IDENTIFICATION IN TRAP COMPLEX, AND FUNCTION OF TRAP COMPLEX.
TISSUE=Cervix carcinoma;
PubMed=10198638; DOI=10.1016/S1097-2765(00)80463-3;
Ito M., Yuan C.-X., Malik S., Gu W., Fondell J.D., Yamamura S.,
Fu Z.-Y., Zhang X., Qin J., Roeder R.G.;
"Identity between TRAP and SMCC complexes indicates novel pathways for
the function of nuclear receptors and diverse mammalian activators.";
Mol. Cell 3:361-370(1999).
[2] {ECO:0000305, ECO:0000312|EMBL:AAD31087.1}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), PROTEIN SEQUENCE OF 27-42 AND
755-772, IDENTIFICATION IN ARC COMPLEX, AND FUNCTION OF ARC COMPLEX.
TISSUE=B-cell {ECO:0000269|PubMed:10235266};
PubMed=10235266; DOI=10.1038/19783;
Rachez C., Lemon B.D., Suldan Z., Bromleigh V., Gamble M.,
Naeaer A.M., Erdjument-Bromage H., Tempst P., Freedman L.P.;
"Ligand-dependent transcription activation by nuclear receptors
requires the DRIP complex.";
Nature 398:824-828(1999).
[3] {ECO:0000312|EMBL:AAH11841.1}
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), AND
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 248-877 (ISOFORM 4).
TISSUE=Skin {ECO:0000312|EMBL:AAH17282.1}, and
Uterus {ECO:0000312|EMBL:AAH11841.1};
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
IDENTIFICATION BY MASS SPECTROMETRY, AND IDENTIFICATION IN THE
MEDIATOR COMPLEX.
PubMed=15175163; DOI=10.1016/j.molcel.2004.05.006;
Sato S., Tomomori-Sato C., Parmely T.J., Florens L., Zybailov B.,
Swanson S.K., Banks C.A.S., Jin J., Cai Y., Washburn M.P.,
Conaway J.W., Conaway R.C.;
"A set of consensus mammalian mediator subunits identified by
multidimensional protein identification technology.";
Mol. Cell 14:685-691(2004).
[5]
INTERACTION WITH MED1; MED10; MED21 AND MED30, IDENTIFICATION BY MASS
SPECTROMETRY, IDENTIFICATION IN THE MEDIATOR COMPLEX, AND ASSOCIATION
OF THE MEDIATOR COMPLEX WITH RNA POLYMERASE II.
PubMed=15989967; DOI=10.1016/j.molcel.2005.05.015;
Zhang X., Krutchinsky A., Fukuda A., Chen W., Yamamura S., Chait B.T.,
Roeder R.G.;
"MED1/TRAP220 exists predominantly in a TRAP/Mediator subpopulation
enriched in RNA polymerase II and is required for ER-mediated
transcription.";
Mol. Cell 19:89-100(2005).
-!- FUNCTION: Component of the Mediator complex, a coactivator
involved in the regulated transcription of nearly all RNA
polymerase II-dependent genes. Mediator functions as a bridge to
convey information from gene-specific regulatory proteins to the
basal RNA polymerase II transcription machinery. Mediator is
recruited to promoters by direct interactions with regulatory
proteins and serves as a scaffold for the assembly of a functional
preinitiation complex with RNA polymerase II and the general
transcription factors. {ECO:0000269|PubMed:10198638,
ECO:0000269|PubMed:10235266}.
-!- SUBUNIT: Component of the Mediator complex, which is composed of
MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13,
MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21,
MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31,
CCNC, CDK8 and CDC2L6/CDK11. The MED12, MED13, CCNC and CDK8
subunits form a distinct module termed the CDK8 module. Mediator
containing the CDK8 module is less active than Mediator lacking
this module in supporting transcriptional activation. Individual
preparations of the Mediator complex lacking one or more distinct
subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and
TRAP. {ECO:0000269|PubMed:10198638, ECO:0000269|PubMed:10235266,
ECO:0000269|PubMed:15175163, ECO:0000269|PubMed:15989967}.
-!- INTERACTION:
O60244:MED14; NbExp=2; IntAct=EBI-394541, EBI-394489;
Q9ULK4:MED23; NbExp=2; IntAct=EBI-394541, EBI-311161;
O75448:MED24; NbExp=2; IntAct=EBI-394541, EBI-394523;
Q71SY5:MED25; NbExp=2; IntAct=EBI-394541, EBI-394558;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=1 {ECO:0000269|PubMed:10198638};
IsoId=Q9Y2X0-1; Sequence=Displayed;
Name=2 {ECO:0000305};
IsoId=Q9Y2X0-2; Sequence=VSP_051724;
Name=3 {ECO:0000305};
IsoId=Q9Y2X0-3; Sequence=VSP_051722, VSP_051724;
Note=No experimental confirmation available. {ECO:0000305};
Name=4 {ECO:0000305};
IsoId=Q9Y2X0-4; Sequence=VSP_051721, VSP_051723;
Note=No experimental confirmation available. {ECO:0000305};
Name=5;
IsoId=Q9Y2X0-5; Sequence=VSP_028749, VSP_028750;
Note=No experimental confirmation available.;
-!- SIMILARITY: Belongs to the Mediator complex subunit 16 family.
{ECO:0000305}.
-!- CAUTION: It is uncertain whether Met-1 or Met-13 is the initiator.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAD31087.1; Type=Frameshift; Positions=609; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF121228; AAD30032.1; -; mRNA.
EMBL; AF106934; AAD31087.1; ALT_FRAME; mRNA.
EMBL; BC004554; AAH04554.1; -; mRNA.
EMBL; BC007853; AAH07853.2; -; mRNA.
EMBL; BC011841; AAH11841.1; -; mRNA.
EMBL; BC017282; AAH17282.1; -; mRNA.
CCDS; CCDS12047.1; -. [Q9Y2X0-1]
RefSeq; NP_005472.2; NM_005481.2. [Q9Y2X0-1]
UniGene; Hs.365207; -.
ProteinModelPortal; Q9Y2X0; -.
BioGrid; 115342; 69.
CORUM; Q9Y2X0; -.
DIP; DIP-31463N; -.
IntAct; Q9Y2X0; 29.
MINT; Q9Y2X0; -.
STRING; 9606.ENSP00000325612; -.
iPTMnet; Q9Y2X0; -.
PhosphoSitePlus; Q9Y2X0; -.
BioMuta; MED16; -.
DMDM; 62511180; -.
EPD; Q9Y2X0; -.
PaxDb; Q9Y2X0; -.
PeptideAtlas; Q9Y2X0; -.
PRIDE; Q9Y2X0; -.
DNASU; 10025; -.
Ensembl; ENST00000312090; ENSP00000308528; ENSG00000175221. [Q9Y2X0-3]
Ensembl; ENST00000325464; ENSP00000325612; ENSG00000175221. [Q9Y2X0-1]
Ensembl; ENST00000395808; ENSP00000379153; ENSG00000175221. [Q9Y2X0-2]
Ensembl; ENST00000589119; ENSP00000464810; ENSG00000175221. [Q9Y2X0-1]
GeneID; 10025; -.
KEGG; hsa:10025; -.
UCSC; uc002lqd.2; human. [Q9Y2X0-1]
CTD; 10025; -.
DisGeNET; 10025; -.
EuPathDB; HostDB:ENSG00000175221.14; -.
GeneCards; MED16; -.
H-InvDB; HIX0015548; -.
HGNC; HGNC:17556; MED16.
HPA; HPA030685; -.
HPA; HPA046495; -.
MIM; 604062; gene.
neXtProt; NX_Q9Y2X0; -.
OpenTargets; ENSG00000175221; -.
PharmGKB; PA162395406; -.
eggNOG; ENOG410IDXV; Eukaryota.
eggNOG; ENOG410ZRDM; LUCA.
GeneTree; ENSGT00390000003821; -.
HOGENOM; HOG000113526; -.
HOVERGEN; HBG054317; -.
InParanoid; Q9Y2X0; -.
KO; K15159; -.
OMA; RPHVLNT; -.
OrthoDB; EOG091G037H; -.
PhylomeDB; Q9Y2X0; -.
Reactome; R-HSA-1989781; PPARA activates gene expression.
Reactome; R-HSA-212436; Generic Transcription Pathway.
Reactome; R-HSA-381340; Transcriptional regulation of white adipocyte differentiation.
SignaLink; Q9Y2X0; -.
ChiTaRS; MED16; human.
GeneWiki; MED16; -.
GenomeRNAi; 10025; -.
PRO; PR:Q9Y2X0; -.
Proteomes; UP000005640; Chromosome 19.
Bgee; ENSG00000175221; -.
CleanEx; HS_MED16; -.
ExpressionAtlas; Q9Y2X0; baseline and differential.
Genevisible; Q9Y2X0; HS.
GO; GO:0016592; C:mediator complex; IDA:UniProtKB.
GO; GO:0016020; C:membrane; HDA:UniProtKB.
GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
GO; GO:0005634; C:nucleus; NAS:UniProtKB.
GO; GO:0003824; F:catalytic activity; IEA:InterPro.
GO; GO:0038023; F:signaling receptor activity; IDA:UniProtKB.
GO; GO:0046966; F:thyroid hormone receptor binding; IDA:UniProtKB.
GO; GO:0030375; F:thyroid hormone receptor coactivator activity; IDA:UniProtKB.
GO; GO:0003713; F:transcription coactivator activity; TAS:ProtInc.
GO; GO:0003712; F:transcription cofactor activity; IDA:UniProtKB.
GO; GO:0042809; F:vitamin D receptor binding; NAS:UniProtKB.
GO; GO:0030521; P:androgen receptor signaling pathway; IDA:UniProtKB.
GO; GO:0030518; P:intracellular steroid hormone receptor signaling pathway; IDA:UniProtKB.
GO; GO:0045893; P:positive regulation of transcription, DNA-templated; IDA:UniProtKB.
GO; GO:0006357; P:regulation of transcription by RNA polymerase II; NAS:UniProtKB.
GO; GO:0006366; P:transcription by RNA polymerase II; TAS:ProtInc.
GO; GO:0006367; P:transcription initiation from RNA polymerase II promoter; IDA:UniProtKB.
Gene3D; 2.130.10.10; -; 1.
InterPro; IPR021665; Mediator_Med16.
InterPro; IPR011041; Quinoprot_gluc/sorb_DH.
InterPro; IPR015943; WD40/YVTN_repeat-like_dom_sf.
InterPro; IPR001680; WD40_repeat.
InterPro; IPR017986; WD40_repeat_dom.
InterPro; IPR036322; WD40_repeat_dom_sf.
Pfam; PF11635; Med16; 1.
SMART; SM00320; WD40; 1.
SUPFAM; SSF50952; SSF50952; 4.
SUPFAM; SSF50978; SSF50978; 1.
PROSITE; PS50082; WD_REPEATS_2; 1.
PROSITE; PS50294; WD_REPEATS_REGION; 1.
1: Evidence at protein level;
Activator; Alternative splicing; Complete proteome;
Direct protein sequencing; Nucleus; Polymorphism; Reference proteome;
Repeat; Transcription; Transcription regulation; WD repeat.
CHAIN 1 877 Mediator of RNA polymerase II
transcription subunit 16.
/FTId=PRO_0000051292.
REPEAT 21 71 WD 1.
REPEAT 72 119 WD 2.
REPEAT 120 165 WD 3.
REPEAT 166 203 WD 4.
REPEAT 204 257 WD 5.
REPEAT 258 334 WD 6.
REPEAT 335 415 WD 7.
REPEAT 416 460 WD 8.
REPEAT 461 495 WD 9.
VAR_SEQ 636 751 GSLLRPGHSFLRDGTSLGMLRELMVVIRIWGLLKPSCLPVY
TATSDTQDSMSLLFRLLTKLWICCRDEGPASEPDEALVDEC
CLLPSQLLIPSLDWLPASDGLVSRLQPKQPLRLQ -> VAM
RAQRASRTRRWWMNAACCPASCLSPAWTGCQPATAWLAACS
PSSPFVCSLAGRPRCLAVLPPCSSTASPGPQASPRSTTCGG
CTLALAPRRNARPAPGAAVSPCSSRPTEPRR (in
isoform 4).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_051721.
VAR_SEQ 636 663 GSLLRPGHSFLRDGTSLGMLRELMVVIR -> PCPTSEPCP
TSEPSPTSEPSPTSEPSSP (in isoform 5).
{ECO:0000303|PubMed:10235266}.
/FTId=VSP_028749.
VAR_SEQ 664 877 Missing (in isoform 5).
{ECO:0000303|PubMed:10235266}.
/FTId=VSP_028750.
VAR_SEQ 700 700 C -> FPSTGPCSVWVLLGWQPLPG (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_051722.
VAR_SEQ 752 877 Missing (in isoform 4).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_051723.
VAR_SEQ 829 877 AVEGRGPDACVTSRASEEAPAFVQLGPQSTHHSPRTPRSLD
HLHPEDRP -> CGGLWWRVPLSYP (in isoform 2
and isoform 3).
{ECO:0000303|PubMed:10235266,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_051724.
VARIANT 770 770 L -> F (in dbSNP:rs34859566).
/FTId=VAR_053958.
VARIANT 874 874 E -> K (in dbSNP:rs13090).
/FTId=VAR_053959.
CONFLICT 46 46 A -> T (in Ref. 1; AAD30032).
{ECO:0000305}.
CONFLICT 211 211 G -> A (in Ref. 2; AAD31087).
{ECO:0000305}.
CONFLICT 412 412 R -> K (in Ref. 1; AAD30032).
{ECO:0000305}.
SEQUENCE 877 AA; 96793 MW; 15173F237A75D230 CRC64;
MCDLRRPAAG GMMDLAYVCE WEKWSKSTHC PSVPLACAWS CRNLIAFTMD LRSDDQDLTR
MIHILDTEHP WDLHSIPSEH HEAITCLEWD QSGSRLLSAD ADGQIKCWSM ADHLANSWES
SVGSLVEGDP IVALSWLHNG VKLALHVEKS GASSFGEKFS RVKFSPSLTL FGGKPMEGWI
AVTVSGLVTV SLLKPSGQVL TSTESLCRLR GRVALADIAF TGGGNIVVAT ADGSSASPVQ
FYKVCVSVVS EKCRIDTEIL PSLFMRCTTD LNRKDKFPAI THLKFLARDM SEQVLLCASS
QTSSIVECWS LRKEGLPVNN IFQQISPVVG DKQPTILKWR ILSATNDLDR VSAVALPKLP
ISLTNTDLKV ASDTQFYPGL GLALAFHDGS VHIVHRLSLQ TMAVFYSSAA PRPVDEPAMK
RPRTAGPAVH LKAMQLSWTS LALVGIDSHG KLSVLRLSPS MGHPLEVGLA LRHLLFLLEY
CMVTGYDWWD ILLHVQPSMV QSLVEKLHEE YTRQTAALQQ VLSTRILAMK ASLCKLSPCT
VTRVCDYHTK LFLIAISSTL KSLLRPHFLN TPDKSPGDRL TEICTKITDV DIDKVMINLK
TEEFVLDMNT LQALQQLLQW VGDFVLYLLA SLPNQGSLLR PGHSFLRDGT SLGMLRELMV
VIRIWGLLKP SCLPVYTATS DTQDSMSLLF RLLTKLWICC RDEGPASEPD EALVDECCLL
PSQLLIPSLD WLPASDGLVS RLQPKQPLRL QFGRAPTLPG SAATLQLDGL ARAPGQPKID
HLRRLHLGAC PTEECKACTR CGCVTMLKSP NRTTAVKQWE QRWIKNCLAV EGRGPDACVT
SRASEEAPAF VQLGPQSTHH SPRTPRSLDH LHPEDRP


Related products :

Catalog number Product name Quantity
18-003-42176 Thyroid hormone receptor-associated protein complex 95 kDa component - Trap95; Thyroid hormone receptor-associated protein 5; Vitamin D3 receptor-interacting protein complex component DRIP92 Polyclona 0.1 mg Protein A
28-735 MED21 belongs to the Mediator complex subunit 21 family. It is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent ge 0.05 mg
EIAAB43730 Homo sapiens,Human,THRAP3,Thyroid hormone receptor-associated protein 3,Thyroid hormone receptor-associated protein complex 150 kDa component,Trap150,TRAP150
EIAAB43728 Rat,Rattus norvegicus,Thrap3,Thyroid hormone receptor-associated protein 3,Thyroid hormone receptor-associated protein complex 150 kDa component,Trap150,Trap150
EIAAB43729 Mouse,Mus musculus,Thrap3,Thyroid hormone receptor-associated protein 3,Thyroid hormone receptor-associated protein complex 150 kDa component,Trap150,Trap150
ARP32301_T200 Anti-Thyroid hormone receptor-associated protein complex 95 kDa component(THRAP5) Species_Reactivity: Human
EIAAB08492 COG complex subunit 1,Cog1,Component of oligomeric Golgi complex 1,Conserved oligomeric Golgi complex subunit 1,Ldlb,Low density lipoprotein receptor defect B-complementing protein,Mouse,Mus musculus
EIAAB08495 COG complex subunit 2,Cog2,Component of oligomeric Golgi complex 2,Conserved oligomeric Golgi complex subunit 2,Ldlc,Low density lipoprotein receptor defect C-complementing protein,Mouse,Mus musculus
EIAAB08494 COG complex subunit 2,COG2,Component of oligomeric Golgi complex 2,Conserved oligomeric Golgi complex subunit 2,Homo sapiens,Human,LDLC,Low density lipoprotein receptor defect C-complementing protein
25-191 MED6 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information 0.05 mg
EIAAB06530 CDK8,Cell division protein kinase 8,Cyclin-dependent kinase 8,Homo sapiens,Human,Mediator complex subunit CDK8,Mediator of RNA polymerase II transcription subunit CDK8,Protein kinase K35
EIAAB09602 Alien homolog,COP9 signalosome complex subunit 2,Cops2,Csn2,JAB1-containing signalosome subunit 2,Mouse,Mus musculus,SGN2,Signalosome subunit 2,Thyroid receptor-interacting protein 15,TR-interacting p
EIAAB06531 Cdk8,Cell division protein kinase 8,Cyclin-dependent kinase 8,Mediator complex subunit CDK8,Mediator of RNA polymerase II transcription subunit CDK8,Mouse,Mus musculus
EIAAB09601 Alien homolog,COP9 signalosome complex subunit 2,COPS2,CSN2,Homo sapiens,Human,JAB1-containing signalosome subunit 2,SGN2,Signalosome subunit 2,Thyroid receptor-interacting protein 15,TR-interacting p
18-003-43113 COP9 signalosome complex subunit 2 - Signalosome subunit 2; SGN2; JAB1-containing signalosome subunit 2; Thyroid receptor-interacting protein 15; Alien homolog Polyclonal 0.1 mg Protein A
18-001-30018 COP9 signalosome complex subunit 2 - Signalosome subunit 2; SGN2; JAB1-containing signalosome subunit 2; Thyroid receptor-interacting protein 15; Alien homolog Polyclonal 0.1 mg
18-003-43113 COP9 signalosome complex subunit 2 - Signalosome subunit 2; SGN2; JAB1-containing signalosome subunit 2; Thyroid receptor-interacting protein 15; Alien homolog Polyclonal 0.05 mg Aff Pur
EIAAB09600 Alien homolog,COP9 signalosome complex subunit 2,Cops2,Csn2,JAB1-containing signalosome subunit 2,Rat,Rattus norvegicus,SGN2,Signalosome subunit 2,Thyroid receptor-interacting protein 15,TR-interactin
EIAAB47949 HNF-4a coactivator,Homo sapiens,Human,Thyroid hormone receptor interactor 3,Thyroid receptor-interacting protein 3,TR-interacting protein 3,TRIP3,TRIP-3,Zinc finger HIT domain-containing protein 3,ZNH
EIAAB30151 Mouse,Mus musculus,Pachytene checkpoint protein 2 homolog,Pch2,Thyroid hormone receptor interactor 13,Thyroid receptor-interacting protein 13,TR-interacting protein 13,Trip13,TRIP-13
EIAAB30147 Pachytene checkpoint protein 2 homolog,Pch2,Rat,Rattus norvegicus,Thyroid hormone receptor interactor 13,Thyroid receptor-interacting protein 13,TR-interacting protein 13,Trip13,TRIP-13
EIAAB47947 Mouse,Mus musculus,Thyroid hormone receptor interactor 3,Thyroid receptor-interacting protein 3,TR-interacting protein 3,Trip3,TRIP-3,Zinc finger HIT domain-containing protein 3,Znhit3
EIAAB30150 Pachytene checkpoint protein 2 homolog,PCH2,Pig,Sus scrofa,Thyroid hormone receptor interactor 13,Thyroid receptor-interacting protein 13,TR-interacting protein 13,TRIP13,TRIP-13
EIAAB26581 CTG repeat protein 26,CTG26,Homo sapiens,Human,NCOR2,N-CoR2,Nuclear receptor corepressor 2,Silencing mediator of retinoic acid and thyroid hormone receptor,SMAP270,SMRT,T3 receptor-associating factor,
27-543 THRAP5 is part of the human thyroid hormone receptor-associated protein (TRAP)-Mediator family which acts as a coactivator for a broad range of nuclear hormone receptors as well as other classes of tr 0.1 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur