Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Membrane progestin receptor delta (mPR delta) (Membrane progesterone P4 receptor delta) (Membrane progesterone receptor delta) (Progesterone and adipoQ receptor family member 6) (Progestin and adipoQ receptor family member 6)

 PAQR6_HUMAN             Reviewed;         344 AA.
Q6TCH4; B7Z9R9; D3DVB4; D3DVB6; Q5TCK9; Q6PDU0; Q7Z4Q7; Q7Z4Q9;
Q8N121; Q8N3M2; Q9H621;
31-AUG-2004, integrated into UniProtKB/Swiss-Prot.
31-AUG-2004, sequence version 2.
27-SEP-2017, entry version 114.
RecName: Full=Membrane progestin receptor delta {ECO:0000303|PubMed:23763432};
Short=mPR delta {ECO:0000303|PubMed:23763432};
AltName: Full=Membrane progesterone P4 receptor delta {ECO:0000303|PubMed:23763432};
AltName: Full=Membrane progesterone receptor delta {ECO:0000303|PubMed:23763432};
AltName: Full=Progesterone and adipoQ receptor family member 6;
AltName: Full=Progestin and adipoQ receptor family member 6 {ECO:0000303|PubMed:16044242};
Name=PAQR6 {ECO:0000312|HGNC:HGNC:30132};
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
TISSUE=Brain;
Zan Q., Guo J.H., Yu L.;
Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND TISSUE SPECIFICITY.
PubMed=16044242; DOI=10.1007/s00239-004-0375-2;
Tang Y.T., Hu T., Arterburn M., Boyle B., Bright J.M., Emtage P.C.,
Funk W.D.;
"PAQR proteins: a novel membrane receptor family defined by an ancient
7-transmembrane pass motif.";
J. Mol. Evol. 61:372-380(2005).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5), AND
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 126-344 (ISOFORMS 1/3/4).
TISSUE=Caudate nucleus, Small intestine, Subcommissural organ, and
Substantia nigra;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Amygdala;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND NUCLEOTIDE
SEQUENCE [LARGE SCALE MRNA] OF 249-344 (ISOFORMS 1/3/4).
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, AND SUBUNIT.
PubMed=23161870; DOI=10.1210/en.2012-1772;
Pang Y., Dong J., Thomas P.;
"Characterization, neurosteroid binding and brain distribution of
human membrane progesterone receptors delta and {epsilon} (mPRdelta
and mPR{epsilon}) and mPRdelta involvement in neurosteroid inhibition
of apoptosis.";
Endocrinology 154:283-295(2013).
[9]
FUNCTION, REVIEW, AND TISSUE SPECIFICITY.
PubMed=23763432; DOI=10.1111/jne.12060;
Petersen S.L., Intlekofer K.A., Moura-Conlon P.J., Brewer D.N.,
Del Pino Sans J., Lopez J.A.;
"Nonclassical progesterone signalling molecules in the nervous
system.";
J. Neuroendocrinol. 25:991-1001(2013).
-!- FUNCTION: Plasma membrane progesterone (P4) receptor coupled to G
proteins (PubMed:23763432, PubMed:23161870). Seems to act through
a G(s) mediated pathway (PubMed:23161870). Involved in
neurosteroid inhibition of apoptosis (PubMed:23161870). May be
involved in regulating rapid P4 signaling in the nervous system
(PubMed:23763432). Also binds dehydroepiandrosterone (DHEA),
pregnanolone, pregnenolone and allopregnanolone (PubMed:23763432,
PubMed:23161870). {ECO:0000269|PubMed:23161870,
ECO:0000303|PubMed:23763432}.
-!- SUBUNIT: Homodimer. {ECO:0000269|PubMed:23161870}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:23161870};
Multi-pass membrane protein {ECO:0000255}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=1;
IsoId=Q6TCH4-1; Sequence=Displayed;
Name=2;
IsoId=Q6TCH4-2; Sequence=VSP_011484, VSP_011485;
Note=Variant in position: 263:E->K (in dbSNP:rs7513351).;
Name=3;
IsoId=Q6TCH4-3; Sequence=VSP_011484;
Name=4;
IsoId=Q6TCH4-4; Sequence=VSP_011483;
Name=5;
IsoId=Q6TCH4-5; Sequence=VSP_054538;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Brain specific (PubMed:16044242,
PubMed:23763432). Highly expressed in the hypothalamus, also
expressed in forebrain, amygdala, corpus callosum and spinal cord
(PubMed:23161870). {ECO:0000269|PubMed:16044242,
ECO:0000269|PubMed:23161870, ECO:0000303|PubMed:23763432}.
-!- MISCELLANEOUS: Non-classical progesterone receptors involved in
extranuclear signaling are classified in 2 groups: the class II
progestin and adipoQ receptor (PAQR) family (also called mPRs)
(PAQR5, PAQR6, PAQR7, PAQR8 and PAQR9) and the b5-like
heme/steroid-binding protein family (also called MAPRs) (PGRMC1,
PGRMC2, NENF and CYB5D2). {ECO:0000303|PubMed:23763432}.
-!- SIMILARITY: Belongs to the ADIPOR family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAP97701.1; Type=Frameshift; Positions=338; Evidence={ECO:0000305};
Sequence=AAP97703.1; Type=Frameshift; Positions=241; Evidence={ECO:0000305};
Sequence=BAB15446.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF455045; AAP97701.1; ALT_FRAME; mRNA.
EMBL; AF455047; AAP97703.1; ALT_FRAME; mRNA.
EMBL; AY424284; AAR08372.1; -; mRNA.
EMBL; AK026325; BAB15446.1; ALT_INIT; mRNA.
EMBL; AK095143; BAC04493.1; -; mRNA.
EMBL; AK095197; BAC04497.1; -; mRNA.
EMBL; AK316034; BAH14405.1; -; mRNA.
EMBL; AL834227; CAD38905.2; -; Transcribed_RNA.
EMBL; AL135927; CAI15542.1; -; Genomic_DNA.
EMBL; CH471121; EAW52976.1; -; Genomic_DNA.
EMBL; CH471121; EAW52977.1; -; Genomic_DNA.
EMBL; CH471121; EAW52979.1; -; Genomic_DNA.
EMBL; CH471121; EAW52982.1; -; Genomic_DNA.
EMBL; CH471121; EAW52983.1; -; Genomic_DNA.
EMBL; BC058509; AAH58509.1; -; mRNA.
CCDS; CCDS1135.1; -. [Q6TCH4-2]
CCDS; CCDS1136.1; -. [Q6TCH4-1]
CCDS; CCDS60301.1; -. [Q6TCH4-5]
RefSeq; NP_001259033.1; NM_001272104.1. [Q6TCH4-1]
RefSeq; NP_001259034.1; NM_001272105.1. [Q6TCH4-5]
RefSeq; NP_001259036.1; NM_001272107.1. [Q6TCH4-3]
RefSeq; NP_001259037.1; NM_001272108.1.
RefSeq; NP_001259038.1; NM_001272109.1.
RefSeq; NP_001259039.1; NM_001272110.1.
RefSeq; NP_001259040.1; NM_001272111.1.
RefSeq; NP_001259041.1; NM_001272112.1.
RefSeq; NP_001259042.1; NM_001272113.1.
RefSeq; NP_079173.2; NM_024897.3. [Q6TCH4-2]
RefSeq; NP_940798.1; NM_198406.2. [Q6TCH4-1]
UniGene; Hs.235873; -.
ProteinModelPortal; Q6TCH4; -.
SMR; Q6TCH4; -.
BioGrid; 123026; 1.
STRING; 9606.ENSP00000338330; -.
iPTMnet; Q6TCH4; -.
PhosphoSitePlus; Q6TCH4; -.
DMDM; 51701773; -.
PaxDb; Q6TCH4; -.
PRIDE; Q6TCH4; -.
Ensembl; ENST00000292291; ENSP00000292291; ENSG00000160781. [Q6TCH4-1]
Ensembl; ENST00000335852; ENSP00000338330; ENSG00000160781. [Q6TCH4-2]
Ensembl; ENST00000356983; ENSP00000349474; ENSG00000160781. [Q6TCH4-5]
Ensembl; ENST00000368270; ENSP00000357253; ENSG00000160781. [Q6TCH4-4]
GeneID; 79957; -.
KEGG; hsa:79957; -.
UCSC; uc001fnu.3; human. [Q6TCH4-1]
CTD; 79957; -.
EuPathDB; HostDB:ENSG00000160781.15; -.
GeneCards; PAQR6; -.
HGNC; HGNC:30132; PAQR6.
HPA; HPA073505; -.
MIM; 614579; gene.
neXtProt; NX_Q6TCH4; -.
OpenTargets; ENSG00000160781; -.
PharmGKB; PA134931897; -.
eggNOG; KOG0748; Eukaryota.
eggNOG; COG1272; LUCA.
GeneTree; ENSGT00530000062965; -.
HOVERGEN; HBG052505; -.
InParanoid; Q6TCH4; -.
OMA; FDIHQVP; -.
PhylomeDB; Q6TCH4; -.
TreeFam; TF319738; -.
ChiTaRS; PAQR6; human.
GenomeRNAi; 79957; -.
PRO; PR:Q6TCH4; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000160781; -.
CleanEx; HS_PAQR6; -.
ExpressionAtlas; Q6TCH4; baseline and differential.
Genevisible; Q6TCH4; HS.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005886; C:plasma membrane; IBA:GO_Central.
GO; GO:0005496; F:steroid binding; IBA:GO_Central.
GO; GO:0003707; F:steroid hormone receptor activity; IBA:GO_Central.
GO; GO:0048545; P:response to steroid hormone; IBA:GO_Central.
InterPro; IPR004254; AdipoR/HlyIII-related.
PANTHER; PTHR20855; PTHR20855; 1.
Pfam; PF03006; HlyIII; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Complete proteome; Lipid-binding;
Membrane; Polymorphism; Receptor; Reference proteome; Steroid-binding;
Transmembrane; Transmembrane helix.
CHAIN 1 344 Membrane progestin receptor delta.
/FTId=PRO_0000218850.
TOPO_DOM 1 51 Cytoplasmic. {ECO:0000255}.
TRANSMEM 52 72 Helical. {ECO:0000255}.
TOPO_DOM 73 83 Extracellular. {ECO:0000255}.
TRANSMEM 84 104 Helical. {ECO:0000255}.
TOPO_DOM 105 113 Cytoplasmic. {ECO:0000255}.
TRANSMEM 114 134 Helical. {ECO:0000255}.
TOPO_DOM 135 147 Extracellular. {ECO:0000255}.
TRANSMEM 148 168 Helical. {ECO:0000255}.
TOPO_DOM 169 217 Cytoplasmic. {ECO:0000255}.
TRANSMEM 218 238 Helical. {ECO:0000255}.
TOPO_DOM 239 258 Extracellular. {ECO:0000255}.
TRANSMEM 259 279 Helical. {ECO:0000255}.
TOPO_DOM 280 292 Cytoplasmic. {ECO:0000255}.
TRANSMEM 293 313 Helical. {ECO:0000255}.
TOPO_DOM 314 344 Extracellular. {ECO:0000255}.
VAR_SEQ 1 106 Missing (in isoform 2 and isoform 3).
{ECO:0000303|PubMed:14702039,
ECO:0000303|Ref.1}.
/FTId=VSP_011484.
VAR_SEQ 1 24 Missing (in isoform 4).
{ECO:0000303|Ref.1}.
/FTId=VSP_011483.
VAR_SEQ 15 17 Missing (in isoform 5).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_054538.
VAR_SEQ 255 344 HSHQLFHICAVLGTHFQLEAVLADMGSRRAWLATQEPALGL
AGTVATLVLAAAGNLLIIAAFTATLLRAPSTCPLLQGGPLE
GGTQAKQQ -> EGTPGPAREEAGADAFPEHRMNWATATSY
STSVQCWAPTSSWRQCWLIWDHAEPGWPHRNLPWAWQAQWP
HWSWLQLGTYSLLLLSQPPCFGPPVHALCCRVAHWRGVPRP
NNSEAPSLTLSWRGQRPGPSADEEPRFGPNQVGTHLSLEPT
GAEERGHRREGREEEGCLGGLAECERDREGALDGSGRSAEG
LRGEMHACPG (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_011485.
CONFLICT 166 166 L -> P (in Ref. 2; AAR08372).
{ECO:0000305}.
CONFLICT 224 224 G -> V (in Ref. 4; CAD38905).
{ECO:0000305}.
CONFLICT 240 242 HLP -> QTD (in Ref. 1; AAP97703).
{ECO:0000305}.
CONFLICT 244 244 R -> G (in Ref. 3; BAC04493).
{ECO:0000305}.
SEQUENCE 344 AA; 37989 MW; BCFDD8A2210A6989 CRC64;
MLSLKLPQLL QVHQVPRVFW EDGIMSGYRR PTSSALDCVL SSFQMTNETV NIWTHFLPTW
YFLWRLLALA GGPGFRAEPY HWPLLVFLLP ACLYPFASCC AHTFSSMSPR MRHICYFLDY
GALSLYSLGC AFPYAAYSMP ASWLHGHLHQ FFVPAAALNS FLCTGLSCYS RFLELESPGL
SKVLRTGAFA YPFLFDNLPL FYRLGLCWGR GHGCGQEALS TSHGYHLFCA LLTGFLFASH
LPERLAPGRF DYIGHSHQLF HICAVLGTHF QLEAVLADMG SRRAWLATQE PALGLAGTVA
TLVLAAAGNL LIIAAFTATL LRAPSTCPLL QGGPLEGGTQ AKQQ


Related products :

Catalog number Product name Quantity
EIAAB25321 C6orf33,Homo sapiens,Human,LMPB1,Lysosomal membrane protein in brain 1,Membrane progestin receptor beta,mPR beta,MPRB,PAQR8,Progestin and adipoQ receptor family member 8,Progestin and adipoQ receptor
EIAAB25327 Homo sapiens,Human,Membrane progestin receptor gamma,mPR gamma,MPRG,PAQR5,Progestin and adipoQ receptor family member 5,Progestin and adipoQ receptor family member V
EIAAB25317 Homo sapiens,Human,Membrane progestin receptor alpha,mPR alpha,MRPA,PAQR7,Progestin and adipoQ receptor family member 7,Progestin and adipoQ receptor family member VII
EIAAB25320 Membrane progestin receptor beta,Mouse,mPR beta,Mprb,Mus musculus,Paqr8,Progestin and adipoQ receptor family member VIII
EIAAB25326 Membrane progestin receptor gamma,Mouse,mPR gamma,Mprg,Mus musculus,Paqr5,Progestin and adipoQ receptor family member V
EIAAB25319 Membrane progestin receptor beta,mPR beta,MPRB,PAQR8,Pig,Progestin and adipoQ receptor family member VIII,Sus scrofa
EIAAB25318 Membrane progestin receptor alpha,mPR alpha,MRPA,PAQR7,Pig,Progestin and adipoQ receptor family member VII,Sus scrofa
EIAAB29863 Homo sapiens,Human,MMD2,Monocyte to macrophage differentiation factor 2,PAQR10,Progestin and adipoQ receptor family member 10,Progestin and adipoQ receptor family member X
EIAAB29865 Homo sapiens,Human,MMD,Monocyte to macrophage differentiation protein,PAQR11,Progestin and adipoQ receptor family member 11,Progestin and adipoQ receptor family member XI
EIAAB29854 Homo sapiens,Human,PAQR3,Progestin and adipoQ receptor family member 3,Progestin and adipoQ receptor family member III,Raf kinase trapping to Golgi,RKTG
EIAAB25316 Membrane progestin receptor alpha,Mouse,mPR alpha,Mpra,Mus musculus,Paqr7,Pglp,PPAR-gamma-induced liver protein,Progestin and adipoQ receptor family member VII
EIAAB29855 Mouse,Mus musculus,Paqr3,Progestin and adipoQ receptor family member 3,Progestin and adipoQ receptor family member III,Raf kinase trapping to Golgi,RKTG
EIAAB29856 MNCb-0914,Mouse,Mus musculus,Paqr4,Progestin and adipoQ receptor family member 4,Progestin and adipoQ receptor family member IV
EIAAB29857 Homo sapiens,Human,PAQR4,Progestin and adipoQ receptor family member 4,Progestin and adipoQ receptor family member IV
EIAAB29861 Homo sapiens,Human,PAQR9,Progestin and adipoQ receptor family member 9,Progestin and adipoQ receptor family member IX
EIAAB29859 Homo sapiens,Human,PAQR6,Progestin and adipoQ receptor family member 6,Progestin and adipoQ receptor family member VI
EIAAB29858 Mouse,Mus musculus,Paqr6,Progestin and adipoQ receptor family member 6,Progestin and adipoQ receptor family member VI
EIAAB29860 Mouse,Mus musculus,Paqr9,Progestin and adipoQ receptor family member 9,Progestin and adipoQ receptor family member IX
E8085h Human Progestin And AdipoQ Receptor Family, Member 96T
E3088h Human Progestin And AdipoQ Receptor Family, Member 96T
EH3504 Progestin and AdipoQ Receptor Family Member VII Elisa Kit 96T
E8083h Human Progestin And AdipoQ Receptor Family, Member 96T
E8084h Human Progestin And AdipoQ Receptor Family, Member 96T
CSB-E11840h Human progestin and adipoQ receptor family member 96T
CSB-E11840h Human progestin and adipoQ receptor family member 96tests


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur