Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Mesoderm induction early response protein 1 (Early response 1) (Er1) (Mi-er1) (hMi-er1)

 MIER1_HUMAN             Reviewed;         512 AA.
Q8N108; C9JFD4; Q08AE0; Q32NC4; Q5T104; Q5TAD1; Q5TAD2; Q5TAD4;
Q5TAD5; Q6AHY8; Q86TB4; Q8N156; Q8N161; Q8NC37; Q8NES4; Q8NES5;
Q8NES6; Q8WWG2; Q9HCG2;
22-NOV-2005, integrated into UniProtKB/Swiss-Prot.
21-MAR-2012, sequence version 2.
22-NOV-2017, entry version 143.
RecName: Full=Mesoderm induction early response protein 1;
Short=Early response 1;
Short=Er1;
Short=Mi-er1;
Short=hMi-er1;
Name=MIER1; Synonyms=KIAA1610;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6), TISSUE
SPECIFICITY, AND SUBCELLULAR LOCATION.
PubMed=12242014; DOI=10.1016/S0378-1119(02)00823-5;
Paterno G.D., Ding Z., Yew Y.-Y., Nash G.W., Mercer F.C.,
Gillespie L.L.;
"Genomic organization of the human mi-er1 gene and characterization of
alternatively spliced isoforms: regulated use of a facultative intron
determines subcellular localization.";
Gene 295:79-88(2002).
[2]
SEQUENCE REVISION.
Paterno G.D., Ding Z., Lew Y.Y., Nash G.W., Mercer F.C.,
Gillespie L.L.;
Submitted (SEP-2011) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), AND NUCLEOTIDE
SEQUENCE [LARGE SCALE MRNA] OF 1-204 (ISOFORMS 1/6).
TISSUE=Testis;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 7).
TISSUE=Retina, and Skeletal muscle;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 8; 9 AND 10), AND
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-199 (ISOFORMS 1/6).
TISSUE=Lung, and Testis;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 29-512 (ISOFORMS 1/2/3/7).
PubMed=10997877; DOI=10.1093/dnares/7.4.271;
Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.;
"Prediction of the coding sequences of unidentified human genes.
XVIII. The complete sequences of 100 new cDNA clones from brain which
code for large proteins in vitro.";
DNA Res. 7:273-281(2000).
[9]
FUNCTION, INTERACTION WITH HDAC1, AND MUTAGENESIS OF TRP-214 AND
227-PHE--LEU-228.
PubMed=12482978; DOI=10.1128/MCB.23.1.250-258.2003;
Ding Z., Gillespie L.L., Paterno G.D.;
"Human MI-ER1 alpha and beta function as transcriptional repressors by
recruitment of histone deacetylase 1 to their conserved ELM2 domain.";
Mol. Cell. Biol. 23:250-258(2003).
[10]
TISSUE SPECIFICITY.
PubMed=9813250; DOI=10.1016/S0378-1119(98)00473-9;
Paterno G.D., Mercer F.C., Chayter J.J., Yang X., Robb J.D.,
Gillespie L.L.;
"Molecular cloning of human er1 cDNA and its differential expression
in breast tumours and tumour-derived cell lines.";
Gene 222:77-82(1998).
[11]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-488, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=17081983; DOI=10.1016/j.cell.2006.09.026;
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,
Mann M.;
"Global, in vivo, and site-specific phosphorylation dynamics in
signaling networks.";
Cell 127:635-648(2006).
[12]
IDENTIFICATION IN A COMPLEX WITH CDYL; MIER2; HDAC1 AND HDAC2.
PubMed=19061646; DOI=10.1016/j.molcel.2008.10.025;
Mulligan P., Westbrook T.F., Ottinger M., Pavlova N., Chang B.,
Macia E., Shi Y.J., Barretina J., Liu J., Howley P.M., Elledge S.J.,
Shi Y.;
"CDYL bridges REST and histone methyltransferases for gene repression
and suppression of cellular transformation.";
Mol. Cell 32:718-726(2008).
[13]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-155; SER-160; SER-166;
SER-483 AND SER-488, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE
SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[14]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-160 AND SER-166, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Leukemic T-cell;
PubMed=19690332; DOI=10.1126/scisignal.2000007;
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,
Rodionov V., Han D.K.;
"Quantitative phosphoproteomic analysis of T cell receptor signaling
reveals system-wide modulation of protein-protein interactions.";
Sci. Signal. 2:RA46-RA46(2009).
[15]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-166 AND SER-483, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=20068231; DOI=10.1126/scisignal.2000475;
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L.,
Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S.,
Mann M.;
"Quantitative phosphoproteomics reveals widespread full
phosphorylation site occupancy during mitosis.";
Sci. Signal. 3:RA3-RA3(2010).
[16]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[17]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-160; SER-166; SER-483
AND SER-488, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
PubMed=21406692; DOI=10.1126/scisignal.2001570;
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J.,
Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V.,
Blagoev B.;
"System-wide temporal characterization of the proteome and
phosphoproteome of human embryonic stem cell differentiation.";
Sci. Signal. 4:RS3-RS3(2011).
[18]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-141; SER-367; SER-369;
SER-377; THR-448; SER-483; SER-488 AND SER-491, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma, and Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[19]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-10 AND SER-377, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
[20]
SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-420, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=25218447; DOI=10.1038/nsmb.2890;
Hendriks I.A., D'Souza R.C., Yang B., Verlaan-de Vries M., Mann M.,
Vertegaal A.C.;
"Uncovering global SUMOylation signaling networks in a site-specific
manner.";
Nat. Struct. Mol. Biol. 21:927-936(2014).
[21]
SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-239 AND LYS-420, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=28112733; DOI=10.1038/nsmb.3366;
Hendriks I.A., Lyon D., Young C., Jensen L.J., Vertegaal A.C.,
Nielsen M.L.;
"Site-specific mapping of the human SUMO proteome reveals co-
modification with phosphorylation.";
Nat. Struct. Mol. Biol. 24:325-336(2017).
-!- FUNCTION: Transcriptional repressor regulating the expression of a
number of genes including SP1 target genes. Probably functions
through recruitment of HDAC1 a histone deacetylase involved in
chromatin silencing. {ECO:0000269|PubMed:12482978}.
-!- SUBUNIT: Interacts with HDAC1. Part of a complex containing at
least CDYL, MIER1, MIER2, HDAC1 and HDAC2.
{ECO:0000269|PubMed:12482978, ECO:0000269|PubMed:19061646}.
-!- INTERACTION:
Q13547:HDAC1; NbExp=7; IntAct=EBI-3504940, EBI-301834;
Q8WVE6:TMEM171; NbExp=3; IntAct=EBI-10264833, EBI-10264837;
-!- SUBCELLULAR LOCATION: Isoform 1: Nucleus.
-!- SUBCELLULAR LOCATION: Isoform 2: Nucleus.
-!- SUBCELLULAR LOCATION: Isoform 3: Nucleus.
-!- SUBCELLULAR LOCATION: Isoform 4: Cytoplasm.
-!- SUBCELLULAR LOCATION: Isoform 5: Cytoplasm.
-!- SUBCELLULAR LOCATION: Isoform 6: Cytoplasm.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=10;
Name=1; Synonyms=N3-beta;
IsoId=Q8N108-11; Sequence=Displayed;
Name=2; Synonyms=N2-beta;
IsoId=Q8N108-12; Sequence=VSP_042450;
Note=Ref.1 (AAM76041/AAM97503/AAM97506) sequences are in
conflict in position: 1:M->L. It is uncertain whether Met-1 or
Met-55 is the initiator. {ECO:0000305};
Name=3; Synonyms=N1-beta;
IsoId=Q8N108-13; Sequence=VSP_042451;
Name=4; Synonyms=N1-alpha;
IsoId=Q8N108-14; Sequence=VSP_042451, VSP_042452, VSP_042453;
Name=5; Synonyms=N2-alpha;
IsoId=Q8N108-15; Sequence=VSP_042450, VSP_042452, VSP_042453;
Note=Ref.1 (AAM97500) sequence is in conflict in position:
1:M->L. It is uncertain whether Met-1 or Met-55 is the
initiator. {ECO:0000305};
Name=6; Synonyms=N3-alpha;
IsoId=Q8N108-16; Sequence=VSP_042452, VSP_042453;
Name=7;
IsoId=Q8N108-17; Sequence=VSP_042449;
Note=No experimental confirmation available.;
Name=8;
IsoId=Q8N108-18; Sequence=VSP_042451, VSP_043218;
Name=9;
IsoId=Q8N108-19; Sequence=VSP_044343, VSP_044344;
Name=10;
IsoId=Q8N108-20; Sequence=VSP_042451, VSP_055710, VSP_055711;
-!- TISSUE SPECIFICITY: Ubiquitously expressed, but at very low
levels. However, consistent level of expression are observed in
heart, testis, thyroid, ovary and adrenal gland. Transcripts are
up-regulated in breast carcinoma cell lines and tumor.
{ECO:0000269|PubMed:12242014, ECO:0000269|PubMed:9813250}.
-!- SEQUENCE CAUTION:
Sequence=AAH17423.1; Type=Miscellaneous discrepancy; Note=Wrong choice of CDS. Probable cloning artifact due to reverse transcription from RNA internal poly-A tracts.; Evidence={ECO:0000305};
Sequence=AAM76041.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=AAM97500.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=AAM97503.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=AAM97506.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=BAC11339.1; Type=Miscellaneous discrepancy; Note=Chimeric cDNA. C-terminal is identical to the product of the WLS gene.; Evidence={ECO:0000305};
Sequence=CAD89921.1; Type=Miscellaneous discrepancy; Note=Wrong choice of CDS.; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology
and Haematology;
URL="http://atlasgeneticsoncology.org/Genes/MIER1ID50389ch1p31.html";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF515446; AAM76040.1; -; mRNA.
EMBL; AF515447; AAM76041.1; ALT_INIT; mRNA.
EMBL; AF515448; AAM76042.2; -; mRNA.
EMBL; AY124186; AAM97499.2; -; mRNA.
EMBL; AY124187; AAM97500.1; ALT_INIT; mRNA.
EMBL; AY124188; AAM97501.1; -; mRNA.
EMBL; AY124189; AAM97502.2; -; mRNA.
EMBL; AY124190; AAM97503.1; ALT_INIT; mRNA.
EMBL; AY124191; AAM97504.1; -; mRNA.
EMBL; AY124192; AAM97505.2; -; mRNA.
EMBL; AY124193; AAM97506.1; ALT_INIT; mRNA.
EMBL; AY124194; AAM97507.1; -; mRNA.
EMBL; AK074990; BAC11339.1; ALT_SEQ; mRNA.
EMBL; AK302061; BAG63451.1; -; mRNA.
EMBL; AL831987; CAD89921.1; ALT_SEQ; mRNA.
EMBL; CR627441; CAH10526.1; -; mRNA.
EMBL; AL139216; CAI18873.1; -; Genomic_DNA.
EMBL; AL500525; CAI18873.1; JOINED; Genomic_DNA.
EMBL; AL139216; CAI18874.1; -; Genomic_DNA.
EMBL; AL500525; CAI18874.1; JOINED; Genomic_DNA.
EMBL; AL139216; CAI18875.1; -; Genomic_DNA.
EMBL; AL500525; CAI18875.1; JOINED; Genomic_DNA.
EMBL; AL139216; CAI18876.1; -; Genomic_DNA.
EMBL; AL500525; CAI18876.1; JOINED; Genomic_DNA.
EMBL; AL139216; CAI18878.1; -; Genomic_DNA.
EMBL; AL500525; CAI18878.1; JOINED; Genomic_DNA.
EMBL; AL139216; CAI18879.1; -; Genomic_DNA.
EMBL; AL500525; CAI18879.1; JOINED; Genomic_DNA.
EMBL; AL500525; CAI23427.1; -; Genomic_DNA.
EMBL; AL139216; CAI23427.1; JOINED; Genomic_DNA.
EMBL; AL500525; CAI23428.1; -; Genomic_DNA.
EMBL; AL139216; CAI23428.1; JOINED; Genomic_DNA.
EMBL; AL500525; CAI23429.1; -; Genomic_DNA.
EMBL; AL139216; CAI23429.1; JOINED; Genomic_DNA.
EMBL; AL500525; CAI23430.1; -; Genomic_DNA.
EMBL; AL139216; CAI23430.1; JOINED; Genomic_DNA.
EMBL; AL500525; CAI23431.1; -; Genomic_DNA.
EMBL; AL139216; CAI23431.1; JOINED; Genomic_DNA.
EMBL; AL500525; CAI23432.1; -; Genomic_DNA.
EMBL; AL139216; CAI23432.1; JOINED; Genomic_DNA.
EMBL; CH471059; EAX06505.1; -; Genomic_DNA.
EMBL; CH471059; EAX06508.1; -; Genomic_DNA.
EMBL; BC017423; AAH17423.1; ALT_SEQ; mRNA.
EMBL; BC066898; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; BC108726; AAI08727.1; -; mRNA.
EMBL; BC125217; AAI25218.1; -; mRNA.
EMBL; BC125218; AAI25219.1; -; mRNA.
EMBL; AB046830; BAB13436.1; -; mRNA.
CCDS; CCDS41347.1; -. [Q8N108-16]
CCDS; CCDS41348.1; -. [Q8N108-11]
CCDS; CCDS53325.1; -. [Q8N108-15]
CCDS; CCDS53326.1; -. [Q8N108-12]
CCDS; CCDS53327.1; -. [Q8N108-14]
CCDS; CCDS53328.1; -. [Q8N108-18]
CCDS; CCDS53329.1; -. [Q8N108-13]
CCDS; CCDS53330.1; -. [Q8N108-19]
CCDS; CCDS60163.1; -. [Q8N108-20]
RefSeq; NP_001071168.2; NM_001077700.2. [Q8N108-12]
RefSeq; NP_001071169.1; NM_001077701.2. [Q8N108-11]
RefSeq; NP_001071170.2; NM_001077702.2. [Q8N108-14]
RefSeq; NP_001071171.2; NM_001077703.2. [Q8N108-15]
RefSeq; NP_001071172.1; NM_001077704.2. [Q8N108-16]
RefSeq; NP_001139582.1; NM_001146110.1. [Q8N108-13]
RefSeq; NP_001139583.1; NM_001146111.1. [Q8N108-18]
RefSeq; NP_001139584.1; NM_001146112.1. [Q8N108-17]
RefSeq; NP_001139585.1; NM_001146113.1. [Q8N108-19]
RefSeq; NP_001265144.1; NM_001278215.1. [Q8N108-20]
RefSeq; NP_065999.2; NM_020948.3. [Q8N108-13]
RefSeq; XP_005271133.1; XM_005271076.3. [Q8N108-13]
RefSeq; XP_016857413.1; XM_017001924.1. [Q8N108-13]
RefSeq; XP_016857414.1; XM_017001925.1. [Q8N108-13]
RefSeq; XP_016857415.1; XM_017001926.1. [Q8N108-13]
RefSeq; XP_016857416.1; XM_017001927.1.
RefSeq; XP_016857417.1; XM_017001928.1.
RefSeq; XP_016857420.1; XM_017001931.1. [Q8N108-17]
UniGene; Hs.605432; -.
ProteinModelPortal; Q8N108; -.
SMR; Q8N108; -.
BioGrid; 121732; 35.
IntAct; Q8N108; 19.
MINT; MINT-4534304; -.
STRING; 9606.ENSP00000383820; -.
iPTMnet; Q8N108; -.
PhosphoSitePlus; Q8N108; -.
BioMuta; MIER1; -.
DMDM; 380865399; -.
EPD; Q8N108; -.
PaxDb; Q8N108; -.
PeptideAtlas; Q8N108; -.
PRIDE; Q8N108; -.
Ensembl; ENST00000355356; ENSP00000347514; ENSG00000198160. [Q8N108-11]
Ensembl; ENST00000355977; ENSP00000348253; ENSG00000198160. [Q8N108-19]
Ensembl; ENST00000357692; ENSP00000350321; ENSG00000198160. [Q8N108-13]
Ensembl; ENST00000371012; ENSP00000360051; ENSG00000198160. [Q8N108-20]
Ensembl; ENST00000371014; ENSP00000360053; ENSG00000198160. [Q8N108-15]
Ensembl; ENST00000371016; ENSP00000360055; ENSG00000198160. [Q8N108-14]
Ensembl; ENST00000371018; ENSP00000360057; ENSG00000198160. [Q8N108-18]
Ensembl; ENST00000401041; ENSP00000383820; ENSG00000198160. [Q8N108-12]
Ensembl; ENST00000401042; ENSP00000383821; ENSG00000198160. [Q8N108-16]
GeneID; 57708; -.
KEGG; hsa:57708; -.
UCSC; uc001dda.6; human. [Q8N108-11]
CTD; 57708; -.
DisGeNET; 57708; -.
EuPathDB; HostDB:ENSG00000198160.14; -.
GeneCards; MIER1; -.
HGNC; HGNC:29657; MIER1.
HPA; HPA019589; -.
HPA; HPA050306; -.
neXtProt; NX_Q8N108; -.
OpenTargets; ENSG00000198160; -.
PharmGKB; PA142671456; -.
eggNOG; KOG4329; Eukaryota.
eggNOG; ENOG410Y9DJ; LUCA.
GeneTree; ENSGT00510000046482; -.
HOGENOM; HOG000015798; -.
HOVERGEN; HBG052923; -.
InParanoid; Q8N108; -.
OMA; VEGLHVN; -.
OrthoDB; EOG091G0BKH; -.
TreeFam; TF106453; -.
ChiTaRS; MIER1; human.
GeneWiki; MIER1; -.
GenomeRNAi; 57708; -.
PRO; PR:Q8N108; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000198160; -.
CleanEx; HS_MIER1; -.
Genevisible; Q8N108; HS.
GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell.
GO; GO:0005654; C:nucleoplasm; IDA:HPA.
GO; GO:0005634; C:nucleus; IDA:UniProtKB.
GO; GO:0043234; C:protein complex; IDA:UniProtKB.
GO; GO:0017053; C:transcriptional repressor complex; IDA:UniProtKB.
GO; GO:0003677; F:DNA binding; IEA:InterPro.
GO; GO:0004407; F:histone deacetylase activity; IDA:UniProtKB.
GO; GO:0042826; F:histone deacetylase binding; IPI:UniProtKB.
GO; GO:0004871; F:signal transducer activity; IMP:UniProtKB.
GO; GO:0016575; P:histone deacetylation; IDA:UniProtKB.
GO; GO:0031937; P:positive regulation of chromatin silencing; IDA:UniProtKB.
GO; GO:0043123; P:positive regulation of I-kappaB kinase/NF-kappaB signaling; IMP:UniProtKB.
GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
InterPro; IPR000949; ELM2_dom.
InterPro; IPR009057; Homeobox-like_sf.
InterPro; IPR031169; MIER1.
InterPro; IPR001005; SANT/Myb.
InterPro; IPR017884; SANT_dom.
PANTHER; PTHR10865:SF24; PTHR10865:SF24; 1.
Pfam; PF01448; ELM2; 1.
Pfam; PF00249; Myb_DNA-binding; 1.
SMART; SM01189; ELM2; 1.
SMART; SM00717; SANT; 1.
SUPFAM; SSF46689; SSF46689; 1.
PROSITE; PS51156; ELM2; 1.
PROSITE; PS51293; SANT; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Cytoplasm; Isopeptide bond;
Nucleus; Phosphoprotein; Reference proteome; Repressor; Transcription;
Transcription regulation; Ubl conjugation.
CHAIN 1 512 Mesoderm induction early response protein
1.
/FTId=PRO_0000197141.
DOMAIN 180 278 ELM2. {ECO:0000255|PROSITE-
ProRule:PRU00512}.
DOMAIN 283 335 SANT. {ECO:0000255|PROSITE-
ProRule:PRU00624}.
REGION 180 284 Interaction with HDAC1.
{ECO:0000269|PubMed:12482978}.
COMPBIAS 36 181 Glu-rich.
MOD_RES 10 10 Phosphoserine.
{ECO:0000244|PubMed:24275569}.
MOD_RES 141 141 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 155 155 Phosphotyrosine.
{ECO:0000244|PubMed:18669648}.
MOD_RES 160 160 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:19690332,
ECO:0000244|PubMed:21406692}.
MOD_RES 166 166 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:19690332,
ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:21406692}.
MOD_RES 367 367 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 369 369 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 377 377 Phosphoserine.
{ECO:0000244|PubMed:23186163,
ECO:0000244|PubMed:24275569}.
MOD_RES 448 448 Phosphothreonine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 483 483 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:21406692,
ECO:0000244|PubMed:23186163}.
MOD_RES 488 488 Phosphoserine.
{ECO:0000244|PubMed:17081983,
ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:21406692,
ECO:0000244|PubMed:23186163}.
MOD_RES 491 491 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
CROSSLNK 239 239 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000244|PubMed:28112733}.
CROSSLNK 420 420 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000244|PubMed:25218447,
ECO:0000244|PubMed:28112733}.
VAR_SEQ 1 63 Missing (in isoform 9).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_044343.
VAR_SEQ 1 27 Missing (in isoform 7).
{ECO:0000303|PubMed:17974005}.
/FTId=VSP_042449.
VAR_SEQ 1 3 MAE -> MDGASSGGGGSSEGGGGSSGSGYGVVARFSQCLA
EFRTWLRTNWLRFNADKTDVML (in isoform 2 and
isoform 5). {ECO:0000303|PubMed:12242014,
ECO:0000303|PubMed:14702039}.
/FTId=VSP_042450.
VAR_SEQ 1 3 MAE -> MFMFNWFTDCLWTLFLSNYQ (in isoform
3, isoform 4, isoform 8 and isoform 10).
{ECO:0000303|PubMed:12242014,
ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:17974005}.
/FTId=VSP_042451.
VAR_SEQ 61 64 EGDM -> VNNM (in isoform 10).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_055710.
VAR_SEQ 65 512 Missing (in isoform 10).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_055711.
VAR_SEQ 412 512 EILNKEEVKVEGLHINGPTGGNKKPLHADMDTNGYETDNLT
TDPKLAHMTARNENDFDEKSERPAKRRRVNSNGKESPGSSE
FFQEAVSHGKFEELENTDD -> ILQMLLPVHFSAISSRAN
AFLK (in isoform 9).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_044344.
VAR_SEQ 412 433 EILNKEEVKVEGLHINGPTGGN -> ILQMLLPVHFSAISS
RANAFLK (in isoform 4, isoform 5 and
isoform 6).
{ECO:0000303|PubMed:12242014}.
/FTId=VSP_042452.
VAR_SEQ 432 512 GNKKPLHADMDTNGYETDNLTTDPKLAHMTARNENDFDEKS
ERPAKRRRVNSNGKESPGSSEFFQEAVSHGKFEELENTDD
-> ILQMLLPVHFSAISSRANAFLK (in isoform 8).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_043218.
VAR_SEQ 434 512 Missing (in isoform 4, isoform 5 and
isoform 6).
{ECO:0000303|PubMed:12242014}.
/FTId=VSP_042453.
MUTAGEN 214 214 W->A: Loss of transcriptional repression
and HDAC1 recruitment activity.
{ECO:0000269|PubMed:12482978}.
MUTAGEN 227 228 FL->AA: Loss of transcriptional
repression and HDAC1 recruitment
activity. {ECO:0000269|PubMed:12482978}.
CONFLICT 14 14 S -> P (in Ref. 7; BC066898).
{ECO:0000305}.
CONFLICT 142 142 Q -> H (in Ref. 4; CAH10526).
{ECO:0000305}.
CONFLICT 156 156 F -> S (in Ref. 3; BAC11339).
{ECO:0000305}.
CONFLICT 237 237 D -> G (in Ref. 4; CAH10526).
{ECO:0000305}.
SEQUENCE 512 AA; 57983 MW; 182C92C7FC5063AD CRC64;
MAEPSVESSS PGGSATSDDH EFDPSADMLV HDFDDERTLE EEEMMEGETN FSSEIEDLAR
EGDMPIHELL SLYGYGSTVR LPEEDEEEEE EEEEGEDDED ADNDDNSGCS GENKEENIKD
SSGQEDETQS SNDDPSQSVA SQDAQEIIRP RRCKYFDTNS EVEEESEEDE DYIPSEDWKK
EIMVGSMFQA EIPVGICRYK ENEKVYENDD QLLWDPEYLP EDKVIIFLKD ASRRTGDEKG
VEAIPEGSHI KDNEQALYEL VKCNFDTEEA LRRLRFNVKA AREELSVWTE EECRNFEQGL
KAYGKDFHLI QANKVRTRSV GECVAFYYMW KKSERYDFFA QQTRFGKKKY NLHPGVTDYM
DRLLDESESA ASSRAPSPPP TASNSSNSQS EKEDGTVSTA NQNGVSSNGP GEILNKEEVK
VEGLHINGPT GGNKKPLHAD MDTNGYETDN LTTDPKLAHM TARNENDFDE KSERPAKRRR
VNSNGKESPG SSEFFQEAVS HGKFEELENT DD


Related products :

Catalog number Product name Quantity
EIAAB24752 Early response 1,Er1,hMi-er1,Homo sapiens,Human,KIAA1610,Mesoderm induction early response protein 1,MIER1,Mi-er1
EIAAB24753 Early response 1,Er1,Kiaa1610,Mesoderm induction early response protein 1,Mier1,Mi-er1,Mouse,Mus musculus
E0549m Chicken ELISA Kit FOR Mesoderm induction early response protein 1 96T
OSR2_BOVIN Chicken ELISA Kit FOR Mesoderm induction early response protein 1 96T
CSB-EL013823HU Human Mesoderm induction early response protein 1(MIER1) ELISA kit 96T
CSB-EL013823CH Chicken Mesoderm induction early response protein 1(MIER1) ELISA kit 96T
EIAAB24759 Mesoderm induction early response protein 3,Mier3,Mi-er3,Mouse,Mus musculus
CSB-EL013825MO Mouse Mesoderm induction early response protein 3(MIER3) ELISA kit 96T
EIAAB24757 Bos taurus,Bovine,Mesoderm induction early response protein 2,MIER2,Mi-er2
CSB-EL013824MO Mouse Mesoderm induction early response protein 2(MIER2) ELISA kit 96T
CSB-EL013825HU Human Mesoderm induction early response protein 3(MIER3) ELISA kit 96T
CSB-EL013823MO Mouse Mesoderm induction early response protein 1(MIER1) ELISA kit 96T
CSB-EL013824HU Human Mesoderm induction early response protein 2(MIER2) ELISA kit 96T
CSB-EL013824BO Bovine Mesoderm induction early response protein 2(MIER2) ELISA kit 96T
CSB-EL013823HU Human Mesoderm induction early response protein 1(MIER1) ELISA kit SpeciesHuman 96T
CSB-EL013824BO Bovine Mesoderm induction early response protein 2(MIER2) ELISA kit SpeciesBovine 96T
CSB-EL013825MO Mouse Mesoderm induction early response protein 3(MIER3) ELISA kit SpeciesMouse 96T
EIAAB24756 Kiaa1193,Mesoderm induction early response protein 2,Mier2,Mi-er2,Mouse,Mus musculus
CSB-EL013824HU Human Mesoderm induction early response protein 2(MIER2) ELISA kit SpeciesHuman 96T
CSB-EL013823CH Chicken Mesoderm induction early response protein 1(MIER1) ELISA kit SpeciesChicken 96T
CSB-EL013824MO Mouse Mesoderm induction early response protein 2(MIER2) ELISA kit SpeciesMouse 96T
CSB-EL013823MO Mouse Mesoderm induction early response protein 1(MIER1) ELISA kit SpeciesMouse 96T
CSB-EL013825HU Human Mesoderm induction early response protein 3(MIER3) ELISA kit SpeciesHuman 96T
EIAAB24758 Homo sapiens,Human,Mesoderm induction early response protein 3,MIER3,Mi-er3
18-003-42536 Mesoderm induction early response 1 - MI-ER1 Polyclonal 0.1 mg Protein A


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur