Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Microtubule-associated tumor suppressor 1 (AT2 receptor-binding protein) (Angiotensin-II type 2 receptor-interacting protein) (Mitochondrial tumor suppressor 1)

 MTUS1_HUMAN             Reviewed;        1270 AA.
Q9ULD2; A8K135; B2RBJ6; B3KWJ9; B4DH03; B9EGA1; D3DSP8; Q63HJ6;
Q659F4; Q6PK49; Q6URW7; Q8N4M6; Q8WTT9; Q9H7T2;
02-OCT-2007, integrated into UniProtKB/Swiss-Prot.
02-OCT-2007, sequence version 2.
22-NOV-2017, entry version 127.
RecName: Full=Microtubule-associated tumor suppressor 1;
AltName: Full=AT2 receptor-binding protein;
AltName: Full=Angiotensin-II type 2 receptor-interacting protein;
AltName: Full=Mitochondrial tumor suppressor 1;
Name=MTUS1; Synonyms=ATBP, ATIP, GK1, KIAA1288, MTSG1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, AND
SUBCELLULAR LOCATION.
PubMed=10697957; DOI=10.1007/s100380050003;
Kinjo T., Isomura M., Iwamasa T., Nakamura Y.;
"Molecular cloning and characterization of two novel genes on
chromosome 8p21.3.";
J. Hum. Genet. 45:12-17(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY,
AND SUBCELLULAR LOCATION.
PubMed=12692079; DOI=10.1096/fj.02-0934fje;
Seibold S., Rudroff C., Weber M., Galle J., Wanner C., Marx M.;
"Identification of a new tumor suppressor gene located at chromosome
8p21.3-22.";
FASEB J. 17:1180-1182(2003).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING (ISOFORMS
1; 5 AND 6), SUBUNIT, AND TISSUE SPECIFICITY.
TISSUE=Lung;
PubMed=15123706; DOI=10.1074/jbc.M403880200;
Nouet S., Amzallag N., Li J.-M., Louis S., Seitz I., Cui T.-X.,
Alleaume A.-M., Di Benedetto M., Boden C., Masson M., Strosberg A.D.,
Horiuchi M., Couraud P.-O., Nahmias C.;
"Trans-inactivation of receptor tyrosine kinases by novel angiotensin
II AT2 receptor-interacting protein, ATIP.";
J. Biol. Chem. 279:28989-28997(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 6 AND 7), AND
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 875-1270 (ISOFORM 1).
TISSUE=Brain, Fetal brain, and Placenta;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), AND NUCLEOTIDE
SEQUENCE [LARGE SCALE MRNA] OF 266-1270 (ISOFORM 5).
TISSUE=Salivary gland, and Uterus;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16421571; DOI=10.1038/nature04406;
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S.,
Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A.,
Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X.,
Allen N.R., Anderson S., Asakawa T., Blechschmidt K., Bloom T.,
Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K.,
DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G.,
Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B.,
Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P.,
Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H.,
Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C.,
O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K.,
Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R.,
Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K.,
Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q.,
Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N.,
Lander E.S.;
"DNA sequence and analysis of human chromosome 8.";
Nature 439:331-335(2006).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], AND VARIANT ARG-148.
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), AND
VARIANTS ARG-148 AND THR-1063.
TISSUE=Ovary, Skin, and Testis;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[9]
NUCLEOTIDE SEQUENCE [MRNA] OF 1-891 (ISOFORM 2), AND VARIANTS ARG-148
AND ARG-575.
Abadie P.A., Genti-Raimondi S.;
"Differential expression in normal trophoblast and gestational
tumors.";
Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases.
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 26-1270 (ISOFORM 1).
TISSUE=Brain;
PubMed=10574462; DOI=10.1093/dnares/6.5.337;
Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.;
"Prediction of the coding sequences of unidentified human genes. XV.
The complete sequences of 100 new cDNA clones from brain which code
for large proteins in vitro.";
DNA Res. 6:337-345(1999).
[11]
TISSUE SPECIFICITY.
PubMed=16270321; DOI=10.1002/cncr.21538;
Pils D., Horak P., Gleiss A., Sax C., Fabjani G., Moebus V.J.,
Zielinski C., Reinthaller A., Zeillinger R., Krainer M.;
"Five genes from chromosomal band 8p22 are significantly down-
regulated in ovarian carcinoma: N33 and EFA6R have a potential impact
on overall survival.";
Cancer 104:2417-2429(2005).
[12]
ALTERNATIVE SPLICING, AND TISSUE SPECIFICITY.
PubMed=16887298; DOI=10.1016/j.gene.2006.05.021;
Di Benedetto M., Bieche I., Deshayes F., Vacher S., Nouet S.,
Collura V., Seitz I., Louis S., Pineau P., Amsellem-Ouazana D.,
Couraud P.-O., Strosberg A.D., Stoppa-Lyonnet D., Lidereau R.,
Nahmias C.;
"Structural organization and expression of human MTUS1, a candidate
8p22 tumor suppressor gene encoding a family of angiotensin II AT2
receptor-interacting proteins, ATIP.";
Gene 380:127-136(2006).
[13]
TISSUE SPECIFICITY.
PubMed=16969489;
Lee S., Bang S., Song K., Lee I.;
"Differential expression in normal-adenoma-carcinoma sequence suggests
complex molecular carcinogenesis in colon.";
Oncol. Rep. 16:747-754(2006).
[14]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[15]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19369195; DOI=10.1074/mcp.M800588-MCP200;
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,
Mann M., Daub H.;
"Large-scale proteomics analysis of the human kinome.";
Mol. Cell. Proteomics 8:1751-1764(2009).
[16]
FUNCTION, ASSOCIATION WITH MICROTUBULES, SUBCELLULAR LOCATION, AND
INDUCTION.
PubMed=19794912; DOI=10.1371/journal.pone.0007239;
Rodrigues-Ferreira S., Di Tommaso A., Dimitrov A., Cazaubon S.,
Gruel N., Colasson H., Nicolas A., Chaverot N., Molinie V., Reyal F.,
Sigal-Zafrani B., Terris B., Delattre O., Radvanyi F., Perez F.,
Vincent-Salomon A., Nahmias C.;
"8p22 MTUS1 gene product ATIP3 is a novel anti-mitotic protein
underexpressed in invasive breast carcinoma of poor prognosis.";
PLoS ONE 4:E7239-E7239(2009).
[17]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1264 AND SER-1268, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Leukemic T-cell;
PubMed=19690332; DOI=10.1126/scisignal.2000007;
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,
Rodionov V., Han D.K.;
"Quantitative phosphoproteomic analysis of T cell receptor signaling
reveals system-wide modulation of protein-protein interactions.";
Sci. Signal. 2:RA46-RA46(2009).
[18]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1224 AND SER-1268, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=20068231; DOI=10.1126/scisignal.2000475;
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L.,
Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S.,
Mann M.;
"Quantitative phosphoproteomics reveals widespread full
phosphorylation site occupancy during mitosis.";
Sci. Signal. 3:RA3-RA3(2010).
[19]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-399; SER-443 AND
SER-1268, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[20]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-186; SER-629 AND
SER-1245, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
[21]
VARIANTS HCC LYS-75; SER-563; HIS-873 AND ARG-1201, AND VARIANTS
ARG-148; MET-425; THR-453; ARG-575; THR-911 AND GLN-1105.
PubMed=16650523; DOI=10.1016/j.mce.2006.03.014;
Di Benedetto M., Pineau P., Nouet S., Berhouet S., Seitz I., Louis S.,
Dejean A., Couraud P.-O., Strosberg A.D., Stoppa-Lyonnet D.,
Nahmias C.;
"Mutation analysis of the 8p22 candidate tumor suppressor gene
ATIP/MTUS1 in hepatocellular carcinoma.";
Mol. Cell. Endocrinol. 252:207-215(2006).
[22]
VARIANTS ARG-148 AND THR-453, VARIANT HNSCC SER-186, AND TISSUE
SPECIFICITY.
PubMed=17656251; DOI=10.1016/j.cancergencyto.2007.04.003;
Ye H., Pungpravat N., Huang B.-L., Muzio L.L., Mariggio M.A., Chen Z.,
Wong D.T., Zhou X.;
"Genomic assessments of the frequent loss of heterozygosity region on
8p21.3 approximately p22 in head and neck squamous cell carcinoma.";
Cancer Genet. Cytogenet. 176:100-106(2007).
-!- FUNCTION: Cooperates with AGTR2 to inhibit ERK2 activation and
cell proliferation. May be required for AGTR2 cell surface
expression. Together with PTPN6, induces UBE2V2 expression upon
angiotensin-II stimulation. Isoform 1 inhibits breast cancer cell
proliferation, delays the progression of mitosis by prolonging
metaphase and reduces tumor growth. {ECO:0000269|PubMed:12692079,
ECO:0000269|PubMed:19794912}.
-!- SUBUNIT: Homodimer. Interacts with AGTR2. Interacts with PTPN6 (By
similarity). Isoform 1 associates with microtubules. {ECO:0000250,
ECO:0000269|PubMed:15123706}.
-!- SUBCELLULAR LOCATION: Mitochondrion {ECO:0000269|PubMed:10697957,
ECO:0000269|PubMed:12692079, ECO:0000269|PubMed:19794912}. Golgi
apparatus {ECO:0000250}. Cell membrane {ECO:0000250}. Nucleus
{ECO:0000250}. Note=In neurons, translocates into the nucleus
after treatment with angiotensin-II. {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Isoform 1: Cytoplasm, cytoskeleton,
microtubule organizing center, centrosome. Cytoplasm,
cytoskeleton, spindle. Note=Localizes with the mitotic spindle
during mitosis and with the intercellular bridge during
cytokinesis.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=7;
Name=1; Synonyms=ATIP3a;
IsoId=Q9ULD2-1; Sequence=Displayed;
Name=2; Synonyms=ATIP3b;
IsoId=Q9ULD2-2; Sequence=VSP_028274;
Name=3; Synonyms=ATIP1;
IsoId=Q9ULD2-3; Sequence=VSP_028271, VSP_028277;
Name=4;
IsoId=Q9ULD2-4; Sequence=VSP_028270, VSP_028278;
Name=5; Synonyms=ATIP2;
IsoId=Q9ULD2-5; Sequence=VSP_028275, VSP_028276;
Note=Expressed at very low levels in most tissues.;
Name=6; Synonyms=ATIP4;
IsoId=Q9ULD2-6; Sequence=VSP_028272, VSP_028273;
Name=7;
IsoId=Q9ULD2-7; Sequence=VSP_044849;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Ubiquitously expressed (at protein level).
Highly expressed in brain. Down-regulated in ovarian carcinoma,
pancreas carcinoma, colon carcinoma and head and neck squamous
cell carcinoma (HNSCC). Isoform 1 is the major isoform in most
peripheral tissues. Isoform 2 is abundant in most peripheral
tissues. Isoform 3 is the major isoform in brain, female
reproductive tissues, thyroid and heart. Within brain it is highly
expressed in corpus callosum and pons. Isoform 6 is brain-
specific, it is the major isoform in cerebellum and fetal brain.
{ECO:0000269|PubMed:10697957, ECO:0000269|PubMed:12692079,
ECO:0000269|PubMed:15123706, ECO:0000269|PubMed:16270321,
ECO:0000269|PubMed:16887298, ECO:0000269|PubMed:16969489,
ECO:0000269|PubMed:17656251}.
-!- INDUCTION: Isoform 1 is down-regulated in invasive breast
carcinomas (at protein level). {ECO:0000269|PubMed:19794912}.
-!- DISEASE: Hepatocellular carcinoma (HCC) [MIM:114550]: A primary
malignant neoplasm of epithelial liver cells. The major risk
factors for HCC are chronic hepatitis B virus (HBV) infection,
chronic hepatitis C virus (HCV) infection, prolonged dietary
aflatoxin exposure, alcoholic cirrhosis, and cirrhosis due to
other causes. {ECO:0000269|PubMed:16650523}. Note=The gene
represented in this entry may be involved in disease pathogenesis.
-!- SIMILARITY: Belongs to the MTUS1 family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAH07328.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence.; Evidence={ECO:0000305};
Sequence=AAH33842.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Sequence=BAB14894.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology
and Haematology;
URL="http://atlasgeneticsoncology.org/Genes/MTUS1ID41451ch8p22.html";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF121259; AAG33674.1; -; mRNA.
EMBL; AF293357; AAL37035.1; -; mRNA.
EMBL; AK024357; BAB14894.1; ALT_INIT; mRNA.
EMBL; AK125188; BAG54161.1; -; mRNA.
EMBL; AK289750; BAF82439.1; -; mRNA.
EMBL; AK294860; BAG57964.1; -; mRNA.
EMBL; AK314692; BAG37243.1; -; mRNA.
EMBL; AL096842; CAB50791.1; -; mRNA.
EMBL; BX648879; CAH56128.1; -; mRNA.
EMBL; AC027117; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC124069; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471080; EAW63804.1; -; Genomic_DNA.
EMBL; CH471080; EAW63805.1; -; Genomic_DNA.
EMBL; CH471080; EAW63810.1; -; Genomic_DNA.
EMBL; BC007328; AAH07328.1; ALT_SEQ; mRNA.
EMBL; BC033842; AAH33842.1; ALT_INIT; mRNA.
EMBL; BC136320; AAI36321.1; -; mRNA.
EMBL; BC142971; AAI42972.1; -; mRNA.
EMBL; AY363099; AAQ24172.1; -; mRNA.
EMBL; AB033114; BAA86602.1; -; mRNA.
CCDS; CCDS43716.1; -. [Q9ULD2-2]
CCDS; CCDS43717.1; -. [Q9ULD2-1]
CCDS; CCDS43718.1; -. [Q9ULD2-6]
CCDS; CCDS43719.1; -. [Q9ULD2-3]
CCDS; CCDS55204.1; -. [Q9ULD2-7]
CCDS; CCDS83254.1; -. [Q9ULD2-4]
RefSeq; NP_001001924.1; NM_001001924.2. [Q9ULD2-1]
RefSeq; NP_001001925.1; NM_001001925.2. [Q9ULD2-2]
RefSeq; NP_001001931.1; NM_001001931.2. [Q9ULD2-6]
RefSeq; NP_001159865.1; NM_001166393.1. [Q9ULD2-7]
RefSeq; NP_001317399.1; NM_001330470.1. [Q9ULD2-4]
RefSeq; NP_065800.1; NM_020749.4. [Q9ULD2-3]
RefSeq; XP_005273636.1; XM_005273579.3. [Q9ULD2-1]
RefSeq; XP_005273639.1; XM_005273582.3. [Q9ULD2-2]
RefSeq; XP_016869189.1; XM_017013700.1. [Q9ULD2-1]
RefSeq; XP_016869190.1; XM_017013701.1. [Q9ULD2-1]
RefSeq; XP_016869191.1; XM_017013702.1. [Q9ULD2-2]
UniGene; Hs.7946; -.
ProteinModelPortal; Q9ULD2; -.
SMR; Q9ULD2; -.
BioGrid; 121573; 24.
IntAct; Q9ULD2; 21.
STRING; 9606.ENSP00000262102; -.
iPTMnet; Q9ULD2; -.
PhosphoSitePlus; Q9ULD2; -.
BioMuta; MTUS1; -.
DMDM; 158706128; -.
EPD; Q9ULD2; -.
PaxDb; Q9ULD2; -.
PeptideAtlas; Q9ULD2; -.
PRIDE; Q9ULD2; -.
Ensembl; ENST00000262102; ENSP00000262102; ENSG00000129422. [Q9ULD2-1]
Ensembl; ENST00000297488; ENSP00000297488; ENSG00000129422. [Q9ULD2-3]
Ensembl; ENST00000381861; ENSP00000371285; ENSG00000129422. [Q9ULD2-6]
Ensembl; ENST00000381869; ENSP00000371293; ENSG00000129422. [Q9ULD2-2]
Ensembl; ENST00000519263; ENSP00000430167; ENSG00000129422. [Q9ULD2-2]
Ensembl; ENST00000544260; ENSP00000445738; ENSG00000129422. [Q9ULD2-7]
Ensembl; ENST00000634613; ENSP00000489288; ENSG00000129422. [Q9ULD2-4]
GeneID; 57509; -.
KEGG; hsa:57509; -.
UCSC; uc003wxs.4; human. [Q9ULD2-1]
CTD; 57509; -.
DisGeNET; 57509; -.
EuPathDB; HostDB:ENSG00000129422.14; -.
GeneCards; MTUS1; -.
HGNC; HGNC:29789; MTUS1.
HPA; HPA067903; -.
HPA; HPA069795; -.
MalaCards; MTUS1; -.
MIM; 114550; phenotype.
MIM; 609589; gene.
neXtProt; NX_Q9ULD2; -.
OpenTargets; ENSG00000129422; -.
PharmGKB; PA134968054; -.
eggNOG; ENOG410IEXM; Eukaryota.
eggNOG; ENOG41118DX; LUCA.
GeneTree; ENSGT00390000006245; -.
HOGENOM; HOG000013016; -.
HOVERGEN; HBG108158; -.
InParanoid; Q9ULD2; -.
OMA; KAKVMSR; -.
OrthoDB; EOG091G0DE4; -.
PhylomeDB; Q9ULD2; -.
TreeFam; TF333416; -.
ChiTaRS; MTUS1; human.
GeneWiki; MTUS1; -.
GenomeRNAi; 57509; -.
PRO; PR:Q9ULD2; -.
Proteomes; UP000005640; Chromosome 8.
Bgee; ENSG00000129422; -.
CleanEx; HS_MTUS1; -.
ExpressionAtlas; Q9ULD2; baseline and differential.
Genevisible; Q9ULD2; HS.
GO; GO:0005615; C:extracellular space; IDA:UniProtKB.
GO; GO:0005794; C:Golgi apparatus; IEA:UniProtKB-SubCell.
GO; GO:0005874; C:microtubule; IEA:UniProtKB-KW.
GO; GO:0015630; C:microtubule cytoskeleton; IDA:HPA.
GO; GO:0005815; C:microtubule organizing center; IEA:UniProtKB-SubCell.
GO; GO:0005739; C:mitochondrion; IEA:UniProtKB-SubCell.
GO; GO:0005730; C:nucleolus; IDA:HPA.
GO; GO:0005886; C:plasma membrane; IEA:UniProtKB-SubCell.
GO; GO:0005819; C:spindle; IEA:UniProtKB-SubCell.
Gene3D; 1.20.1270.60; -; 1.
InterPro; IPR027267; AH/BAR_dom_sf.
InterPro; IPR029786; MTUS1.
PANTHER; PTHR24200:SF7; PTHR24200:SF7; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Coiled coil; Complete proteome;
Cytoplasm; Cytoskeleton; Disease mutation; Golgi apparatus; Membrane;
Microtubule; Mitochondrion; Nucleus; Phosphoprotein; Polymorphism;
Reference proteome; Tumor suppressor.
CHAIN 1 1270 Microtubule-associated tumor suppressor
1.
/FTId=PRO_0000305197.
COILED 940 1231 {ECO:0000255}.
MOD_RES 186 186 Phosphothreonine.
{ECO:0000244|PubMed:24275569}.
MOD_RES 381 381 Phosphoserine.
{ECO:0000250|UniProtKB:Q5HZI1}.
MOD_RES 399 399 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 443 443 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 629 629 Phosphoserine.
{ECO:0000244|PubMed:24275569}.
MOD_RES 1203 1203 Phosphoserine.
{ECO:0000250|UniProtKB:Q6IMY1}.
MOD_RES 1224 1224 Phosphoserine.
{ECO:0000244|PubMed:20068231}.
MOD_RES 1245 1245 Phosphoserine.
{ECO:0000244|PubMed:24275569}.
MOD_RES 1255 1255 Phosphoserine.
{ECO:0000250|UniProtKB:Q5HZI1}.
MOD_RES 1259 1259 Phosphoserine.
{ECO:0000250|UniProtKB:Q6IMY1}.
MOD_RES 1261 1261 Phosphoserine.
{ECO:0000250|UniProtKB:Q5HZI1}.
MOD_RES 1264 1264 Phosphoserine.
{ECO:0000244|PubMed:19690332}.
MOD_RES 1268 1268 Phosphoserine.
{ECO:0000244|PubMed:19690332,
ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:23186163}.
VAR_SEQ 1 928 Missing (in isoform 4).
{ECO:0000303|PubMed:17974005}.
/FTId=VSP_028270.
VAR_SEQ 1 855 Missing (in isoform 7).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_044849.
VAR_SEQ 1 834 Missing (in isoform 3).
{ECO:0000303|PubMed:12692079,
ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15123706,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_028271.
VAR_SEQ 1 753 Missing (in isoform 6).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_028272.
VAR_SEQ 754 817 QRIRRVSSSGKPTSLKTAQSSWVNLPRPLPKSKASLKSPAL
RRTGSTPSIASTHSELSTYSNNS -> MTVPGGFRSCTETD
ISSKIFINSTLTPPAGSERHYDATLLTLLVVGSYSLCIIPL
LATFTGKKT (in isoform 6).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_028273.
VAR_SEQ 763 817 GKPTSLKTAQSSWVNLPRPLPKSKASLKSPALRRTGSTPSI
ASTHSELSTYSNNS -> A (in isoform 2).
{ECO:0000303|Ref.9}.
/FTId=VSP_028274.
VAR_SEQ 763 770 GKPTSLKT -> VLPKAAFS (in isoform 5).
{ECO:0000303|PubMed:17974005}.
/FTId=VSP_028275.
VAR_SEQ 771 1270 Missing (in isoform 5).
{ECO:0000303|PubMed:17974005}.
/FTId=VSP_028276.
VAR_SEQ 835 874 QNGSSGSFYLKPLVSRAHVHLMKTPPKGPSRKNLFTALNA
-> MLLSPKFSLSTIHIRLTAKGLLRNLRLPSGFRRSTVVF
HT (in isoform 3).
{ECO:0000303|PubMed:12692079,
ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15123706,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_028277.
VAR_SEQ 929 946 GNTKFEALTVVIQHLLSE -> MGCPSSKLCLYSPCAATR
(in isoform 4).
{ECO:0000303|PubMed:17974005}.
/FTId=VSP_028278.
VARIANT 75 75 Q -> K (in HCC; dbSNP:rs61733703).
{ECO:0000269|PubMed:16650523}.
/FTId=VAR_035173.
VARIANT 148 148 C -> R (in dbSNP:rs3739407).
{ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:16650523,
ECO:0000269|PubMed:17656251,
ECO:0000269|Ref.7, ECO:0000269|Ref.9}.
/FTId=VAR_035174.
VARIANT 186 186 T -> S (in HNSCC cell lines;
dbSNP:rs141609607).
{ECO:0000269|PubMed:17656251}.
/FTId=VAR_035175.
VARIANT 425 425 T -> M (in dbSNP:rs61733694).
{ECO:0000269|PubMed:16650523}.
/FTId=VAR_035176.
VARIANT 453 453 K -> T (in dbSNP:rs17690844).
{ECO:0000269|PubMed:16650523,
ECO:0000269|PubMed:17656251}.
/FTId=VAR_035177.
VARIANT 563 563 A -> S (in HCC).
{ECO:0000269|PubMed:16650523}.
/FTId=VAR_035178.
VARIANT 575 575 H -> R (in dbSNP:rs209569).
{ECO:0000269|PubMed:16650523,
ECO:0000269|Ref.9}.
/FTId=VAR_035179.
VARIANT 873 873 N -> H (in HCC; dbSNP:rs187103704).
{ECO:0000269|PubMed:16650523}.
/FTId=VAR_035180.
VARIANT 911 911 K -> T (in dbSNP:rs61748836).
{ECO:0000269|PubMed:16650523}.
/FTId=VAR_035181.
VARIANT 1063 1063 K -> T (in dbSNP:rs17853231).
{ECO:0000269|PubMed:15489334}.
/FTId=VAR_035182.
VARIANT 1105 1105 E -> Q (in dbSNP:rs61733705).
{ECO:0000269|PubMed:16650523}.
/FTId=VAR_035183.
VARIANT 1201 1201 Q -> R (in HCC; dbSNP:rs567116808).
{ECO:0000269|PubMed:16650523}.
/FTId=VAR_035184.
CONFLICT 266 266 C -> G (in Ref. 5; CAB50791).
{ECO:0000305}.
CONFLICT 918 918 F -> L (in Ref. 4; BAG37243).
{ECO:0000305}.
CONFLICT 999 999 E -> G (in Ref. 5; CAH56128).
{ECO:0000305}.
CONFLICT 1149 1149 I -> T (in Ref. 4; BAB14894).
{ECO:0000305}.
SEQUENCE 1270 AA; 141397 MW; 2EAE962F627BFFE3 CRC64;
MTDDNSDDKI EDELQTFFTS DKDGNTHAYN PKSPPTQNSS ASSVNWNSAN PDDMVVDYET
DPAVVTGENI SLSLQGVEVF GHEKSSSDFI SKQVLDMHKD SICQCPALVG TEKPKYLQHS
CHSLEAVEGQ SVEPSLPFVW KPNDNLNCAG YCDALELNQT FDMTVDKVNC TFISHHAIGK
SQSFHTAGSL PPTGRRSGST SSLSYSTWTS SHSDKTHARE TTYDRESFEN PQVTPSEAQD
MTYTAFSDVV MQSEVFVSDI GNQCACSSGK VTSEYTDGSQ QRLVGEKETQ ALTPVSDGME
VPNDSALQEF FCLSHDESNS EPHSQSSYRH KEMGQNLRET VSYCLIDDEC PLMVPAFDKS
EAQVLNPEHK VTETEDTQMV SKGKDLGTQN HTSELILSSP PGQKVGSSFG LTWDANDMVI
STDKTMCMST PVLEPTKVTF SVSPIEATEK CKKVEKGNRG LKNIPDSKEA PVNLCKPSLG
KSTIKTNTPI GCKVRKTEII SYPRPNFKNV KAKVMSRAVL QPKDAALSKV TPRPQQTSAS
SPSSVNSRQQ TVLSRTPRSD LNADKKAEIL INKTHKQQFN KLITSQAVHV TTHSKNASHR
VPRTTSAVKS NQEDVDKASS SNSACETGSV SALFQKIKGI LPVKMESAEC LEMTYVPNID
RISPEKKGEK ENGTSMEKQE LKQEIMNETF EYGSLFLGSA SKTTTTSGRN ISKPDSCGLR
QIAAPKAKVG PPVSCLRRNS DNRNPSADRA VSPQRIRRVS SSGKPTSLKT AQSSWVNLPR
PLPKSKASLK SPALRRTGST PSIASTHSEL STYSNNSGNA AVIKYEEKPP KPAFQNGSSG
SFYLKPLVSR AHVHLMKTPP KGPSRKNLFT ALNAVEKSRQ KNPRSLCIQP QTAPDALPPE
KTLELTQYKT KCENQSGFIL QLKQLLACGN TKFEALTVVI QHLLSEREEA LKQHKTLSQE
LVNLRGELVT ASTTCEKLEK ARNELQTVYE AFVQQHQAEK TERENRLKEF YTREYEKLRD
TYIEEAEKYK MQLQEQFDNL NAAHETSKLE IEASHSEKLE LLKKAYEASL SEIKKGHEIE
KKSLEDLLSE KQESLEKQIN DLKSENDALN EKLKSEEQKR RAREKANLKN PQIMYLEQEL
ESLKAVLEIK NEKLHQQDIK LMKMEKLVDN NTALVDKLKR FQQENEELKA RMDKHMAISR
QLSTEQAVLQ ESLEKESKVN KRLSMENEEL LWKLHNGDLC SPKRSPTSSA IPLQSPRNSG
SFPSPSISPR


Related products :

Catalog number Product name Quantity
EIAAB25786 Angiotensin-II type 2 receptor-interacting protein,AT2 receptor-binding protein,ATBP,ATIP,GK1,Homo sapiens,Human,KIAA1288,Microtubule-associated tumor suppressor 1,Mitochondrial tumor suppressor 1,MTS
EIAAB25784 Angiotensin-II type 2 receptor-interacting protein,AT2 receptor-binding protein,Atbp,Atip,Cctsg1,Coiled-coiled tumor suppressor gene 1 protein,Kiaa1288,Microtubule-associated tumor suppressor 1 homolo
EIAAB25787 Angiotensin-II type 2 receptor-interacting protein,Atip,Microtubule-associated tumor suppressor 1 homolog,Mitochondrial tumor suppressor 1 homolog,Mtsg1,Mtus1,Rat,Rattus norvegicus
EIAAB25785 Bos taurus,Bovine,Microtubule-associated tumor suppressor 1 homolog,Mitochondrial tumor suppressor 1 homolog,MTUS1
30-622 ING1 is a tumor suppressor protein that can induce cell growth arrest and apoptosis. The protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a componen 0.1 mg
EIAAB10579 Colorectal cancer suppressor,DCC,Homo sapiens,Human,IGDCC1,Immunoglobulin superfamily DCC subclass member 1,Netrin receptor DCC,Tumor suppressor protein DCC
OBT1120 MOUSE ANTI PTEN TUMOR SUPPRESSOR PROTEIN, Product Type Monoclonal Antibody, Specificity PTEN TUMOR SUPPRESSOR PROTEIN, Target Species Human, Host Mouse, Format Purified, Isotypes IgG1, Applicati 0.1 mg
SCH-OBT1120 MOUSE ANTI PTEN TUMOR SUPPRESSOR PROTEIN, Product Type Monoclonal Antibody, Specificity PTEN TUMOR SUPPRESSOR PROTEIN, Target Species Human, Host Mouse, Format Purified, Isotypes IgG1, Applicati 0.1 mg
EIAAB43851 B-cell chronic lymphocytic leukemia tumor suppressor Leu5,E3 ubiquitin-protein ligase TRIM13,Homo sapiens,Human,LEU5,Leukemia-associated protein 5,Putative tumor suppressor RFP2,Ret finger protein 2,R
18-003-42487 Ret finger protein 2 - Leukemia-associated protein 5; B-cell chronic lymphocytic leukemia tumor suppressor Leu5; Putative tumor suppressor RFP2; Tripartite motif-containing protein 13; RING finger pro 0.05 mg Aff Pur
18-003-42488 Ret finger protein 2 - Leukemia-associated protein 5; B-cell chronic lymphocytic leukemia tumor suppressor Leu5; Putative tumor suppressor RFP2; Tripartite motif-containing protein 13; RING finger pro 0.1 mg Protein A
32-172 p16 (cyclin-dependent kinase inhibitor 2A, INK4a) is a tumor suppressor protein. It is a specific inhibitor of Cdk 4 _ Cdk 6, and a tumor suppressor involved in the pathogenesis of a variety of malign 0.1 mL
EIAAB31151 67-11-3 protein,Liver-related putative tumor suppressor,Lpts,LPTS1,Mouse,Mus musculus,PIN2_TERF1-interacting telomerase inhibitor 1,Pin2-interacting protein X1,Pinx1,TRF1-interacting protein 1
EIAAB31153 Homo sapiens,Human,Liver-related putative tumor suppressor,LPTL,LPTS,PIN2_TERF1-interacting telomerase inhibitor 1,Pin2-interacting protein X1,PINX1,Protein 67-11-3,TRF1-interacting protein 1
EIAAB13585 FAM10A1,Hip,HIP,Homo sapiens,Hsc70-interacting protein,Human,Progesterone receptor-associated p48 protein,Protein FAM10A1,Putative tumor suppressor ST13,Renal carcinoma antigen NY-REN-33,SNC6,ST13,Sup
EIAAB30719 Homo sapiens,Human,PDGF receptor beta-like tumor suppressor,PDGFRL,PDGFR-like protein,Platelet-derived growth factor receptor-like protein,PRLTS
EIAAB41715 Homo sapiens,Human,Mitochondrial protein with oncostatic activity,Mitostatin,Protein TCHP,TCHP,Trichoplein keratin filament-binding protein,Tumor suppressor protein
MCA4811Z MOUSE ANTI HUMAN PTEN TUMOR SUPPRESSOR PROTEIN Azide free, Product Type Monoclonal Antibody, Specificity PTEN TUMOR SUPPRESSOR PROTEIN, Target Species Human, Host Mouse, Format Azide Free, Isotyp 0.1 mg
Y050532 Anti_DDC(Netrin receptor DCC precursor) (Tumor suppressor protein DCC) 100ug
EIAAB10578 Dcc,Mouse,Mus musculus,Netrin receptor DCC,Tumor suppressor protein DCC
EIAAB25788 Cardiac zipper protein,Cazip,Kiaa0774,Microtubule plus-end tracking protein TIP150,Microtubule-associated tumor suppressor candidate 2 homolog,Mouse,Mtus2,Mus musculus,Tip150,Tracking protein of 150 k
EIAAB25789 Cardiac zipper protein,CAZIP,Homo sapiens,Human,KIAA0774,Microtubule plus-end tracking protein TIP150,Microtubule-associated tumor suppressor candidate 2,MTUS2,TIP150,Tracking protein of 150 kDa
Y050532 Anti-DDC(Netrin receptor DCC precursor) (Tumor suppressor protein DCC) Antibody 100ug
Y050532 Anti-DDCNetrin receptor DCC precursor Tumor suppressor protein DCC antibody 250ug
EIAAB34908 60S ribosomal protein L10,DXS648E,Homo sapiens,Human,Laminin receptor homolog,Protein QM,QM,RPL10,Tumor suppressor QM


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur