Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Mitochondrial import inner membrane translocase subunit TIM50

 TIM50_HUMAN             Reviewed;         353 AA.
Q3ZCQ8; Q330K1; Q6QA00; Q96FJ5; Q96GY2; Q9H370;
06-DEC-2005, integrated into UniProtKB/Swiss-Prot.
06-DEC-2005, sequence version 2.
23-MAY-2018, entry version 131.
RecName: Full=Mitochondrial import inner membrane translocase subunit TIM50;
Flags: Precursor;
Name=TIMM50; Synonyms=TIM50; ORFNames=PRO1512;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR
LOCATION, TISSUE SPECIFICITY, AND INTERACTION WITH TIMM23.
PubMed=15044455; DOI=10.1074/jbc.M402049200;
Guo Y., Cheong N., Zhang Z., De Rose R., Deng Y., Farber S.A.,
Fernandes-Alnemri T., Alnemri E.S.;
"Tim50, a component of the mitochondrial translocator, regulates
mitochondrial integrity and cell death.";
J. Biol. Chem. 279:24813-24825(2004).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
Zheng H., Xie Y., Mao Y.;
"Cloning of a novel splice variant of TIM50L.";
Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15057824; DOI=10.1038/nature02399;
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J.,
Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M.,
Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E.,
Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M.,
Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C.,
Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M.,
Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T.,
Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H.,
Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S.,
Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J.,
Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M.,
Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J.,
Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D.,
Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A.,
Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I.,
Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E.,
Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M.,
Rubin E.M., Lucas S.M.;
"The DNA sequence and biology of human chromosome 19.";
Nature 428:529-535(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), AND PARTIAL
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Brain, Eye, and Pancreas;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 68-353.
TISSUE=Fetal liver;
Zhang C., Yu Y., Zhang S., Wei H., Bi J., Zhou G., Dong C., Zai Y.,
Xu W., Gao F., Liu M., He F.;
"Functional prediction of the coding sequences of 75 new genes deduced
by analysis of cDNA clones from human fetal liver.";
Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases.
[6]
PROTEIN SEQUENCE OF 98-113; 275-284; 285-295 AND 335-345, AND
IDENTIFICATION BY MASS SPECTROMETRY.
TISSUE=B-cell lymphoma;
Bienvenut W.V.;
Submitted (JUN-2005) to UniProtKB.
[7]
PROTEIN SEQUENCE OF 98-113, AND IDENTIFICATION BY MASS SPECTROMETRY.
TISSUE=Brain, and Cajal-Retzius cell;
Lubec G., Afjehi-Sadat L.;
Submitted (MAR-2007) to UniProtKB.
[8]
ALTERNATIVE SPLICING (ISOFORM 2), FUNCTION (ISOFORM 2), RNA-BINDING
(ISOFORM 2), SUBCELLULAR LOCATION (ISOFORM 2), TISSUE SPECIFICITY, AND
INTERACTION WITH COIL.
PubMed=16008839; DOI=10.1186/1471-2121-6-29;
Xu H., Somers Z.B., Robinson M.L. II, Hebert M.D.;
"Tim50a, a nuclear isoform of the mitochondrial Tim50, interacts with
proteins involved in snRNP biogenesis.";
BMC Cell Biol. 6:29-29(2005).
[9]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[10]
INTERACTION WITH DNAJC15.
PubMed=23263864; DOI=10.1093/hmg/dds541;
Schusdziarra C., Blamowska M., Azem A., Hell K.;
"Methylation-controlled J-protein MCJ acts in the import of proteins
into human mitochondria.";
Hum. Mol. Genet. 22:1348-1357(2013).
[11]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-45 AND SER-341, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[12]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=25944712; DOI=10.1002/pmic.201400617;
Vaca Jacome A.S., Rabilloud T., Schaeffer-Reiss C., Rompais M.,
Ayoub D., Lane L., Bairoch A., Van Dorsselaer A., Carapito C.;
"N-terminome analysis of the human mitochondrial proteome.";
Proteomics 15:2519-2524(2015).
[13]
INVOLVEMENT IN MGCA9, AND VARIANTS MGCA9 TRP-114 AND MET-149.
PubMed=27573165; DOI=10.1111/cge.12855;
NISC Intramural Sequencing;
Shahrour M.A., Staretz-Chacham O., Dayan D., Stephen J., Weech A.,
Damseh N., Pri Chen H., Edvardson S., Mazaheri S., Saada A.,
Hershkovitz E., Shaag A., Huizing M., Abu-Libdeh B., Gahl W.A.,
Azem A., Anikster Y., Vilboux T., Elpeleg O., Malicdan M.C.;
"Mitochondrial epileptic encephalopathy, 3-methylglutaconic aciduria
and variable complex V deficiency associated with TIMM50 mutations.";
Clin. Genet. 91:690-696(2017).
-!- FUNCTION: Essential component of the TIM23 complex, a complex that
mediates the translocation of transit peptide-containing proteins
across the mitochondrial inner membrane. Has some phosphatase
activity in vitro; however such activity may not be relevant in
vivo. {ECO:0000269|PubMed:15044455}.
-!- FUNCTION: Isoform 2: May participate in the release of snRNPs and
SMN from the Cajal body. {ECO:0000269|PubMed:16008839}.
-!- SUBUNIT: Component of the TIM23 complex at least composed of
TIMM23, TIMM17 (TIMM17A or TIMM17B) and TIMM50; within this
complex, directly interacts with TIMM23 (PubMed:15044455). The
complex interacts with the TIMM44 component of the PAM complex and
with DNAJC15 (PubMed:23263864). Isoform 2: Interacts with COIL and
snRNPs (PubMed:16008839). {ECO:0000269|PubMed:15044455,
ECO:0000269|PubMed:16008839, ECO:0000269|PubMed:23263864}.
-!- INTERACTION:
P10398:ARAF; NbExp=4; IntAct=EBI-355175, EBI-365961;
P04049:RAF1; NbExp=4; IntAct=EBI-355175, EBI-365996;
-!- SUBCELLULAR LOCATION: Mitochondrion inner membrane
{ECO:0000269|PubMed:15044455}; Single-pass membrane protein
{ECO:0000269|PubMed:15044455}.
-!- SUBCELLULAR LOCATION: Isoform 2: Nucleus speckle
{ECO:0000269|PubMed:16008839}. Note=Nuclear and enriched in
speckles with snRNPs. {ECO:0000269|PubMed:16008839}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q3ZCQ8-1; Sequence=Displayed;
Name=2; Synonyms=Tim50a;
IsoId=Q3ZCQ8-2; Sequence=VSP_016389;
Name=3;
IsoId=Q3ZCQ8-3; Sequence=VSP_047682, VSP_047683;
-!- TISSUE SPECIFICITY: Widely expressed. Expressed at higher level in
brain, kidney and liver (at protein level).
{ECO:0000269|PubMed:15044455, ECO:0000269|PubMed:16008839}.
-!- DOMAIN: The FCP1 homology domain does not contain the canonical D-
x-D-x-[TV] active site, suggesting that it probably does not
display phosphatase activity in vivo.
-!- DISEASE: 3-methylglutaconic aciduria 9 (MGCA9) [MIM:617698]: An
autosomal recessive disease characterized by early-onset seizures,
severely delayed psychomotor development and intellectual
disability. Patients have hypotonia or spasticity, and laboratory
investigations show increased serum lactate and 3-methylglutaconic
aciduria. {ECO:0000269|PubMed:27573165}. Note=The disease is
caused by mutations affecting the gene represented in this entry.
-!- SIMILARITY: Belongs to the TIM50 family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAG35534.1; Type=Miscellaneous discrepancy; Note=Chimera.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AY551341; AAT01208.1; -; mRNA.
EMBL; AY444561; AAS68537.1; -; mRNA.
EMBL; AC011500; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC009072; AAH09072.1; -; mRNA.
EMBL; BC010736; AAH10736.1; -; mRNA.
EMBL; BC050082; AAH50082.1; -; mRNA.
EMBL; BC121146; AAI21147.1; -; mRNA.
EMBL; AF130109; AAG35534.1; ALT_SEQ; mRNA.
CCDS; CCDS33023.1; -. [Q3ZCQ8-2]
RefSeq; NP_001001563.1; NM_001001563.3. [Q3ZCQ8-2]
RefSeq; NP_001316488.1; NM_001329559.1. [Q3ZCQ8-3]
UniGene; Hs.590956; -.
UniGene; Hs.597106; -.
ProteinModelPortal; Q3ZCQ8; -.
SMR; Q3ZCQ8; -.
BioGrid; 124961; 103.
CORUM; Q3ZCQ8; -.
DIP; DIP-34058N; -.
IntAct; Q3ZCQ8; 50.
MINT; Q3ZCQ8; -.
STRING; 9606.ENSP00000318115; -.
iPTMnet; Q3ZCQ8; -.
PhosphoSitePlus; Q3ZCQ8; -.
SwissPalm; Q3ZCQ8; -.
BioMuta; TIMM50; -.
DMDM; 83305924; -.
EPD; Q3ZCQ8; -.
MaxQB; Q3ZCQ8; -.
PaxDb; Q3ZCQ8; -.
PeptideAtlas; Q3ZCQ8; -.
PRIDE; Q3ZCQ8; -.
TopDownProteomics; Q3ZCQ8-1; -. [Q3ZCQ8-1]
TopDownProteomics; Q3ZCQ8-2; -. [Q3ZCQ8-2]
DNASU; 92609; -.
Ensembl; ENST00000314349; ENSP00000318115; ENSG00000105197. [Q3ZCQ8-2]
Ensembl; ENST00000544017; ENSP00000445806; ENSG00000105197. [Q3ZCQ8-2]
Ensembl; ENST00000607714; ENSP00000475531; ENSG00000105197. [Q3ZCQ8-1]
GeneID; 92609; -.
KEGG; hsa:92609; -.
UCSC; uc002olu.1; human. [Q3ZCQ8-1]
CTD; 92609; -.
DisGeNET; 92609; -.
EuPathDB; HostDB:ENSG00000105197.10; -.
GeneCards; TIMM50; -.
H-InvDB; HIX0040029; -.
HGNC; HGNC:23656; TIMM50.
HPA; HPA048843; -.
HPA; HPA056448; -.
MalaCards; TIMM50; -.
MIM; 607381; gene.
MIM; 617698; phenotype.
neXtProt; NX_Q3ZCQ8; -.
OpenTargets; ENSG00000105197; -.
PharmGKB; PA134902846; -.
eggNOG; KOG2832; Eukaryota.
eggNOG; COG5190; LUCA.
GeneTree; ENSGT00550000075036; -.
HOVERGEN; HBG084157; -.
InParanoid; Q3ZCQ8; -.
KO; K17496; -.
OMA; RMKLGFA; -.
PhylomeDB; Q3ZCQ8; -.
TreeFam; TF106198; -.
Reactome; R-HSA-1268020; Mitochondrial protein import.
ChiTaRS; TIMM50; human.
GeneWiki; TIMM50; -.
GenomeRNAi; 92609; -.
PRO; PR:Q3ZCQ8; -.
Proteomes; UP000005640; Chromosome 19.
Bgee; ENSG00000105197; -.
CleanEx; HS_TIMM50; -.
ExpressionAtlas; Q3ZCQ8; baseline and differential.
Genevisible; Q3ZCQ8; HS.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005743; C:mitochondrial inner membrane; IDA:UniProtKB.
GO; GO:0005744; C:mitochondrial inner membrane presequence translocase complex; IPI:UniProtKB.
GO; GO:0005739; C:mitochondrion; IDA:HPA.
GO; GO:0016607; C:nuclear speck; IDA:UniProtKB.
GO; GO:0005654; C:nucleoplasm; IDA:HPA.
GO; GO:0005134; F:interleukin-2 receptor binding; IDA:MGI.
GO; GO:0004721; F:phosphoprotein phosphatase activity; IDA:MGI.
GO; GO:0004722; F:protein serine/threonine phosphatase activity; IDA:UniProtKB.
GO; GO:0004725; F:protein tyrosine phosphatase activity; IDA:UniProtKB.
GO; GO:0043021; F:ribonucleoprotein complex binding; IDA:UniProtKB.
GO; GO:0003723; F:RNA binding; IEA:UniProtKB-KW.
GO; GO:0007006; P:mitochondrial membrane organization; IMP:UniProtKB.
GO; GO:0006470; P:protein dephosphorylation; IDA:UniProtKB.
GO; GO:0030150; P:protein import into mitochondrial matrix; IBA:GO_Central.
GO; GO:0001836; P:release of cytochrome c from mitochondria; IDA:MGI.
Gene3D; 3.40.50.1000; -; 1.
InterPro; IPR004274; FCP1_dom.
InterPro; IPR036412; HAD-like_sf.
InterPro; IPR023214; HAD_sf.
InterPro; IPR027111; Tim50.
PANTHER; PTHR12210:SF3; PTHR12210:SF3; 1.
Pfam; PF03031; NIF; 1.
SMART; SM00577; CPDc; 1.
SUPFAM; SSF56784; SSF56784; 1.
PROSITE; PS50969; FCP1; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Direct protein sequencing;
Disease mutation; Epilepsy; Membrane; Mental retardation;
Mitochondrion; Mitochondrion inner membrane; Nucleus; Phosphoprotein;
Polymorphism; Protein transport; Reference proteome; RNA-binding;
Transit peptide; Translocation; Transmembrane; Transmembrane helix;
Transport.
TRANSIT 1 44 Mitochondrion. {ECO:0000255}.
CHAIN 45 353 Mitochondrial import inner membrane
translocase subunit TIM50.
/FTId=PRO_0000043115.
TOPO_DOM 45 65 Mitochondrial matrix. {ECO:0000255}.
TRANSMEM 66 86 Helical. {ECO:0000255}.
TOPO_DOM 87 353 Mitochondrial intermembrane.
{ECO:0000255}.
DOMAIN 143 286 FCP1 homology. {ECO:0000255|PROSITE-
ProRule:PRU00336}.
MOD_RES 45 45 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 341 341 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
VAR_SEQ 1 11 MAASAAVFSRL -> MVPRFLMSSTM (in isoform
3). {ECO:0000303|PubMed:15489334,
ECO:0000303|Ref.2}.
/FTId=VSP_047682.
VAR_SEQ 1 1 M -> MASALSLGNKCDPFLRCVLCRGGGALQGPRGRGPDD
FESQLSPPGSARRLVRSKRACGNPPDAFGLSRASVHPPLPR
VSIGCSSGPGRAKRERVGGAAWRQRKM (in isoform
2). {ECO:0000305}.
/FTId=VSP_016389.
VAR_SEQ 12 124 Missing (in isoform 3).
{ECO:0000303|PubMed:15489334,
ECO:0000303|Ref.2}.
/FTId=VSP_047683.
VARIANT 114 114 R -> W (in MGCA9; unknown pathological
significance).
{ECO:0000269|PubMed:27573165}.
/FTId=VAR_078568.
VARIANT 149 149 T -> M (in MGCA9; unknown pathological
significance).
{ECO:0000269|PubMed:27573165}.
/FTId=VAR_078569.
SEQUENCE 353 AA; 39646 MW; 524EB9989BBF6988 CRC64;
MAASAAVFSR LRSGLRLGSR GLCTRLATPP RRAPDQAAEI GSRGSTKAQG PQQQPGSEGP
SYAKKVALWL AGLLGAGGTV SVVYIFGNNP VDENGAKIPD EFDNDPILVQ QLRRTYKYFK
DYRQMIIEPT SPCLLPDPLQ EPYYQPPYTL VLELTGVLLH PEWSLATGWR FKKRPGIETL
FQQLAPLYEI VIFTSETGMT AFPLIDSVDP HGFISYRLFR DATRYMDGHH VKDISCLNRD
PARVVVVDCK KEAFRLQPYN GVALRPWDGN SDDRVLLDLS AFLKTIALNG VEDVRTVLEH
YALEDDPLAA FKQRQSRLEQ EEQQRLAELS KSNKQNLFLG SLTSRLWPRS KQP


Related products :

Catalog number Product name Quantity
EIAAB42435 Bos taurus,Bovine,Mitochondrial import inner membrane translocase subunit TIM50,TIM50,TIMM50
EIAAB42436 Mitochondrial import inner membrane translocase subunit TIM50,Mouse,Mus musculus,Tim50,Timm50
EIAAB42437 Homo sapiens,Human,Mitochondrial import inner membrane translocase subunit TIM50,PRO1512,TIM50,TIMM50
E12152h Bovine ELISA Kit FOR Mitochondrial import inner membrane translocase subunit TIM50 96T
CSB-EL023556HU Human Mitochondrial import inner membrane translocase subunit TIM50(TIMM50) ELISA kit 96T
CSB-EL023556MO Mouse Mitochondrial import inner membrane translocase subunit TIM50(TIMM50) ELISA kit 96T
CSB-EL023556BO Bovine Mitochondrial import inner membrane translocase subunit TIM50(TIMM50) ELISA kit 96T
CSB-EL023556MO Mouse Mitochondrial import inner membrane translocase subunit TIM50(TIMM50) ELISA kit SpeciesMouse 96T
CSB-EL023556BO Bovine Mitochondrial import inner membrane translocase subunit TIM50(TIMM50) ELISA kit SpeciesBovine 96T
CSB-EL023556HU Human Mitochondrial import inner membrane translocase subunit TIM50(TIMM50) ELISA kit SpeciesHuman 96T
TIM50_MOUSE ELISA Kit FOR Mitochondrial import inner membrane translocase subunit TIM50; organism: Mouse; gene name: Timm50 96T
EIAAB43416 D16Wsu109e,Mitochondrial import receptor subunit TOM70,Mitochondrial precursor proteins import receptor,Mouse,Mus musculus,Tomm70a,Translocase of outer membrane 70 kDa subunit
EIAAB43418 Mitochondrial import receptor subunit TOM70,Mitochondrial precursor proteins import receptor,Rat,Rattus norvegicus,Tomm70a,Translocase of outer membrane 70 kDa subunit
EIAAB43417 Homo sapiens,Human,KIAA0719,Mitochondrial import receptor subunit TOM70,Mitochondrial precursor proteins import receptor,TOM70,TOMM70A,Translocase of outer membrane 70 kDa subunit
EIAAB42348 Inner membrane preprotein translocase Tim17a,Mitochondrial import inner membrane translocase subunit Tim17-A,Mouse,Mus musculus,Tim17a,Timm17a
EIAAB42347 Homo sapiens,Human,Inner membrane preprotein translocase Tim17a,MIMT17,Mitochondrial import inner membrane translocase subunit Tim17-A,TIM17,TIM17A,TIMM17,TIMM17A
EIAAB42349 Inner membrane preprotein translocase Tim17a,Mimt17,Mitochondrial import inner membrane translocase subunit Tim17-A,Rat,Rattus norvegicus,Tim17,Tim17a,Timm17,Timm17a
T10B_RAT Rat ELISA Kit FOR Mitochondrial import inner membrane translocase subunit Tim10 B 96T
E1165m Rat ELISA Kit FOR Mitochondrial import inner membrane translocase subunit Tim13 96T
E1810r Rat ELISA Kit FOR Mitochondrial import inner membrane translocase subunit Tim8 B 96T
E1225r Rat ELISA Kit FOR Mitochondrial import inner membrane translocase subunit Tim9 B 96T
E1213c Rat ELISA Kit FOR Mitochondrial import inner membrane translocase subunit Tim10 96T
EIAAB43400 Mitochondrial import receptor subunit TOM34,Mouse,Mus musculus,Tomm34,Translocase of outer membrane 34 kDa subunit
EIAAB43399 Mitochondrial import receptor subunit TOM34,Rat,Rattus norvegicus,Tomm34,Translocase of outer membrane 34 kDa subunit
CSB-EL009085RA Rat Mitochondrial import inner membrane translocase subunit Tim9 B(FXC1) ELISA kit 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur