Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Mucin-3A (MUC-3A) (Intestinal mucin-3A)

 MUC3A_HUMAN             Reviewed;        3323 AA.
Q02505; A6NP22; O14650; O14651; O43418; O43421; Q02506; Q6W763;
Q9H3Q7; Q9UKW9; Q9UN93; Q9UN94; Q9UN95;
01-JUN-1994, integrated into UniProtKB/Swiss-Prot.
13-APR-2016, sequence version 3.
25-OCT-2017, entry version 132.
RecName: Full=Mucin-3A {ECO:0000305};
Short=MUC-3A {ECO:0000305};
AltName: Full=Intestinal mucin-3A {ECO:0000305|PubMed:12958310};
Flags: Precursor;
Name=MUC3A {ECO:0000312|HGNC:HGNC:7513};
Synonyms=MUC3 {ECO:0000303|PubMed:10405327};
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12853948; DOI=10.1038/nature01782;
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H.,
Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R.,
Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E.,
Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H.,
Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A.,
Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J.,
Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A.,
Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S.,
Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M.,
Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C.,
Latreille P., Miller N., Johnson D., Murray J., Woessner J.P.,
Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J.,
Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L.,
Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R.,
Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E.,
Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K.,
Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S.,
Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M.,
Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R.,
Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D.,
Waterston R.H., Wilson R.K.;
"The DNA sequence of human chromosome 7.";
Nature 424:157-164(2003).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-340 (ISOFORM 1).
PubMed=12958310; DOI=10.1074/jbc.M305769200;
Gum J.R. Jr., Hicks J.W., Crawley S.C., Dahl C.M., Yang S.C.,
Roberton A.M., Kim Y.S.;
"Initiation of transcription of the MUC3A human intestinal mucin from
a TATA-less promoter and comparison with the MUC3B amino terminus.";
J. Biol. Chem. 278:49600-49609(2003).
[3]
NUCLEOTIDE SEQUENCE [MRNA] OF 1003-1515 AND 1530-1969 (ISOFORM 1), AND
NUCLEOTIDE SEQUENCE [MRNA] OF 2097-3323 (ISOFORM 2).
PubMed=9334251; DOI=10.1074/jbc.272.42.26678;
Gum J.R. Jr., Ho J.J.L., Pratt W.S., Hicks J.W., Hill A.S.,
Vinall L.E., Roberton A.M., Swallow D.M., Kim Y.S.;
"MUC3 human intestinal mucin. Analysis of gene structure, the carboxyl
terminus, and a novel upstream repetitive region.";
J. Biol. Chem. 272:26678-26686(1997).
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 2097-3323 (ISOFORM 1),
ALTERNATIVE SPLICING (ISOFORMS 2; 3 AND 4), VARIANT ASN-3299, AND
SUBCELLULAR LOCATION.
TISSUE=Intestine;
PubMed=10512748; DOI=10.1006/bbrc.1999.1466;
Crawley S.C., Gum J.R. Jr., Hicks J.W., Pratt W.S., Aubert J.-P.,
Swallow D.M., Kim Y.S.;
"Genomic organization and structure of the 3' region of human MUC3:
alternative splicing predicts membrane-bound and soluble forms of the
mucin.";
Biochem. Biophys. Res. Commun. 263:728-736(1999).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 2447-3323 (ISOFORM 1), TISSUE
SPECIFICITY, AND VARIANTS ALA-3120; ASN-3299 AND HIS-3299.
PubMed=11289722; DOI=10.1007/s100380170118;
Kyo K., Muto T., Nagawa H., Lathrop G.M., Nakamura Y.;
"Associations of distinct variants of the intestinal mucin gene MUC3A
with ulcerative colitis and Crohn's disease.";
J. Hum. Genet. 46:5-20(2001).
[6]
NUCLEOTIDE SEQUENCE [MRNA] OF 2958-3323 (ISOFORMS 1; 2 AND 5), AND
FUNCTION.
TISSUE=Colon mucosa, and Small intestine;
PubMed=10405327; DOI=10.1006/bbrc.1999.1001;
Williams S.J., Munster D.J., Quin R.J., Gotley D.C., McGuckin M.A.;
"The MUC3 gene encodes a transmembrane mucin and is alternatively
spliced.";
Biochem. Biophys. Res. Commun. 261:83-89(1999).
[7]
PARTIAL NUCLEOTIDE SEQUENCE [MRNA].
TISSUE=Small intestine;
PubMed=2393399; DOI=10.1016/0006-291X(90)91408-K;
Gum J.R. Jr., Hicks J.W., Swallow D.M., Lagace R.L., Byrd J.C.,
Lamport D.T.A., Siddiki B., Kim Y.S.;
"Molecular cloning of cDNAs derived from a novel human intestinal
mucin gene.";
Biochem. Biophys. Res. Commun. 171:407-415(1990).
[8]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
-!- FUNCTION: Major glycoprotein component of a variety of mucus gels.
Thought to provide a protective, lubricating barrier against
particles and infectious agents at mucosal surfaces. May be
involved in ligand binding and intracellular signaling.
{ECO:0000269|PubMed:10405327}.
-!- SUBCELLULAR LOCATION: Isoform 1: Membrane; Single-pass membrane
protein {ECO:0000255}.
-!- SUBCELLULAR LOCATION: Isoform 2: Secreted
{ECO:0000303|PubMed:10512748}.
-!- SUBCELLULAR LOCATION: Isoform 3: Secreted
{ECO:0000303|PubMed:10512748}.
-!- SUBCELLULAR LOCATION: Isoform 4: Secreted
{ECO:0000303|PubMed:10512748}.
-!- SUBCELLULAR LOCATION: Isoform 5: Secreted.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Comment=Additional isoforms seem to exist.;
Name=1;
IsoId=Q02505-1; Sequence=Displayed;
Name=2;
IsoId=Q02505-2; Sequence=VSP_023229, VSP_023231;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
Name=3;
IsoId=Q02505-3; Sequence=VSP_023230, VSP_023233;
Name=4;
IsoId=Q02505-4; Sequence=VSP_023232, VSP_023234;
Name=5;
IsoId=Q02505-5; Sequence=VSP_023235;
-!- TISSUE SPECIFICITY: Broad specificity; small intestine, colon,
colonic tumors, heart, liver, thymus, prostate, pancreas and gall
bladder. {ECO:0000269|PubMed:11289722}.
-!- PTM: Highly O-glycosylated and probably also N-glycosylated.
-!- SEQUENCE CAUTION:
Sequence=AAA63772.1; Type=Miscellaneous discrepancy; Note=This sequence is incomplete at 5' and 3' ends and extensively differs from that shown.; Evidence={ECO:0000305};
Sequence=AAA63773.1; Type=Miscellaneous discrepancy; Note=This sequence is incomplete at 5' and 3' ends and extensively differs from that shown.; Evidence={ECO:0000305};
Sequence=AAC02271.1; Type=Frameshift; Positions=1535, 1542, 1548; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=Mucin database;
URL="http://www.medkem.gu.se/mucinbiology/databases/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AC105446; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC118759; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC254629; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AY307930; AAQ73824.1; -; Genomic_DNA.
EMBL; AF007190; AAC02268.1; -; mRNA.
EMBL; AF007193; AAC02271.1; ALT_FRAME; mRNA.
EMBL; AF007194; AAC02272.1; -; mRNA.
EMBL; AF113616; AAF13032.1; -; Genomic_DNA.
EMBL; AB038782; BAB12116.1; -; Genomic_DNA.
EMBL; AF143371; AAD45882.1; -; mRNA.
EMBL; AF143372; AAD45883.1; -; mRNA.
EMBL; AF143373; AAD45884.1; -; mRNA.
EMBL; M55405; AAA63772.1; ALT_SEQ; mRNA.
EMBL; M55406; AAA63773.1; ALT_SEQ; mRNA.
CCDS; CCDS78262.1; -. [Q02505-1]
PIR; A35690; A35690.
PIR; B35690; B35690.
RefSeq; NP_005951.1; NM_005960.1. [Q02505-1]
UniGene; Hs.703577; -.
UniGene; Hs.723567; -.
UniGene; Hs.744422; -.
UniGene; Hs.744530; -.
ProteinModelPortal; Q02505; -.
SMR; Q02505; -.
IntAct; Q02505; 1.
STRING; 9606.ENSP00000324834; -.
iPTMnet; Q02505; -.
PhosphoSitePlus; Q02505; -.
DMDM; 126302571; -.
PaxDb; Q02505; -.
PeptideAtlas; Q02505; -.
PRIDE; Q02505; -.
Ensembl; ENST00000379458; ENSP00000368771; ENSG00000169894. [Q02505-1]
Ensembl; ENST00000483366; ENSP00000483541; ENSG00000169894. [Q02505-5]
GeneID; 4584; -.
KEGG; hsa:4584; -.
UCSC; uc033aad.2; human.
UCSC; uc064gjo.1; human. [Q02505-1]
CTD; 4584; -.
DisGeNET; 4584; -.
EuPathDB; HostDB:ENSG00000169894.17; -.
GeneCards; MUC3A; -.
HGNC; HGNC:7513; MUC3A.
HPA; HPA010871; -.
MIM; 158371; gene.
neXtProt; NX_Q02505; -.
OpenTargets; ENSG00000169894; -.
eggNOG; ENOG410IVGW; Eukaryota.
eggNOG; ENOG410ZCSE; LUCA.
GeneTree; ENSGT00730000111040; -.
HOVERGEN; HBG099390; -.
InParanoid; Q02505; -.
KO; K22016; -.
OMA; TINGIPQ; -.
OrthoDB; EOG091G02EJ; -.
Reactome; R-HSA-5083625; Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC).
Reactome; R-HSA-5083632; Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS).
Reactome; R-HSA-5083636; Defective GALNT12 causes colorectal cancer 1 (CRCS1).
Reactome; R-HSA-5621480; Dectin-2 family.
Reactome; R-HSA-913709; O-linked glycosylation of mucins.
Reactome; R-HSA-977068; Termination of O-glycan biosynthesis.
ChiTaRS; MUC3A; human.
GenomeRNAi; 4584; -.
PRO; PR:Q02505; -.
Proteomes; UP000005640; Chromosome 7.
Bgee; ENSG00000169894; -.
ExpressionAtlas; Q02505; baseline and differential.
Genevisible; Q02505; HS.
GO; GO:0005576; C:extracellular region; NAS:UniProtKB.
GO; GO:0005796; C:Golgi lumen; TAS:Reactome.
GO; GO:0016021; C:integral component of membrane; NAS:UniProtKB.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0030197; F:extracellular matrix constituent, lubricant activity; NAS:UniProtKB.
GO; GO:0005201; F:extracellular matrix structural constituent; NAS:UniProtKB.
GO; GO:0016266; P:O-glycan processing; TAS:Reactome.
GO; GO:0002223; P:stimulatory C-type lectin receptor signaling pathway; TAS:Reactome.
InterPro; IPR013032; EGF-like_CS.
InterPro; IPR000742; EGF-like_dom.
InterPro; IPR000082; SEA_dom.
InterPro; IPR036364; SEA_dom_sf.
SMART; SM00181; EGF; 2.
SMART; SM00200; SEA; 1.
SUPFAM; SSF82671; SSF82671; 1.
PROSITE; PS00022; EGF_1; 2.
PROSITE; PS01186; EGF_2; 1.
PROSITE; PS50026; EGF_3; 1.
PROSITE; PS50024; SEA; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Disulfide bond;
EGF-like domain; Glycoprotein; Membrane; Polymorphism;
Reference proteome; Repeat; Secreted; Signal; Transmembrane;
Transmembrane helix.
SIGNAL 1 15 {ECO:0000255}.
CHAIN 16 3323 Mucin-3A.
/FTId=PRO_0000158955.
TRANSMEM 3227 3247 Helical. {ECO:0000255}.
REPEAT 1893 1910 1.
REPEAT 1911 1927 2.
REPEAT 1928 1944 3.
REPEAT 1945 1961 4.
REPEAT 1962 1978 5.
REPEAT 1979 1995 6.
REPEAT 1996 2012 7.
REPEAT 2013 2029 8.
REPEAT 2030 2046 9.
REPEAT 2047 2062 10.
REPEAT 2063 2079 11.
REPEAT 2080 2096 12.
REPEAT 2097 2113 13.
REPEAT 2114 2130 14.
REPEAT 2131 2147 15.
REPEAT 2148 2164 16.
REPEAT 2165 2191 17.
REPEAT 2192 2208 18.
REPEAT 2209 2225 19.
REPEAT 2226 2242 20.
REPEAT 2243 2259 21.
REPEAT 2260 2276 22.
REPEAT 2277 2293 23.
REPEAT 2294 2310 24.
REPEAT 2311 2327 25.
REPEAT 2328 2344 26.
REPEAT 2345 2361 27.
REPEAT 2362 2378 28.
REPEAT 2379 2395 29.
REPEAT 2396 2412 30.
REPEAT 2413 2429 31.
REPEAT 2430 2446 32.
DOMAIN 2976 3009 EGF-like. {ECO:0000255|PROSITE-
ProRule:PRU00076}.
DOMAIN 3018 3143 SEA. {ECO:0000255|PROSITE-
ProRule:PRU00188}.
REGION 1893 2446 32 X approximate tandem repeats, Ser/Thr-
rich.
COMPBIAS 77 2957 Thr-rich.
COMPBIAS 395 2747 Ser-rich.
DISULFID 2980 2986 {ECO:0000255|PROSITE-ProRule:PRU00076}.
DISULFID 2999 3008 {ECO:0000255|PROSITE-ProRule:PRU00076}.
VAR_SEQ 3019 3063 VVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQK
IFAD -> AEDFCRHAGLHLQGCGDPVPEEWQHRGGLPGPA
GDALQPPAGERV (in isoform 2).
{ECO:0000303|PubMed:10405327,
ECO:0000303|PubMed:9334251}.
/FTId=VSP_023229.
VAR_SEQ 3057 3080 MQKIFADMQGFTFKGVEILSLRNG -> EWQHRGGLPGPAG
DALQPPAGERV (in isoform 3).
{ECO:0000305|PubMed:10512748}.
/FTId=VSP_023230.
VAR_SEQ 3064 3323 Missing (in isoform 2).
{ECO:0000303|PubMed:10405327,
ECO:0000303|PubMed:9334251}.
/FTId=VSP_023231.
VAR_SEQ 3078 3081 RNGS -> SPVF (in isoform 4).
{ECO:0000305|PubMed:10512748}.
/FTId=VSP_023232.
VAR_SEQ 3081 3323 Missing (in isoform 3).
{ECO:0000305|PubMed:10512748}.
/FTId=VSP_023233.
VAR_SEQ 3082 3323 Missing (in isoform 4).
{ECO:0000305|PubMed:10512748}.
/FTId=VSP_023234.
VAR_SEQ 3204 3261 Missing (in isoform 5).
{ECO:0000303|PubMed:10405327}.
/FTId=VSP_023235.
VARIANT 3120 3120 V -> A (in dbSNP:rs6960868).
{ECO:0000269|PubMed:11289722}.
/FTId=VAR_030722.
VARIANT 3299 3299 Y -> H (polymorphism; may be associated
with Crohn disease; dbSNP:rs10258821).
{ECO:0000269|PubMed:11289722}.
/FTId=VAR_030724.
VARIANT 3299 3299 Y -> N (in dbSNP:rs10258821).
{ECO:0000269|PubMed:10512748,
ECO:0000269|PubMed:11289722}.
/FTId=VAR_030723.
CONFLICT 258 258 P -> S (in Ref. 1; AAQ73824).
{ECO:0000305}.
CONFLICT 337 337 T -> P (in Ref. 1; AAQ73824).
{ECO:0000305}.
CONFLICT 1149 1149 L -> H (in Ref. 3; AAC02268).
{ECO:0000305}.
CONFLICT 1234 1234 T -> K (in Ref. 3; AAC02268).
{ECO:0000305}.
CONFLICT 1542 1542 P -> L (in Ref. 3; AAC02271).
{ECO:0000305}.
CONFLICT 1570 1570 G -> D (in Ref. 3; AAC02271).
{ECO:0000305}.
CONFLICT 1587 1587 S -> T (in Ref. 3; AAC02271).
{ECO:0000305}.
CONFLICT 1640 1640 P -> S (in Ref. 3; AAC02271).
{ECO:0000305}.
CONFLICT 1966 1969 ETTS -> DSIV (in Ref. 3; AAC02271).
{ECO:0000305}.
CONFLICT 2099 2099 T -> I (in Ref. 4; AAF13032 and 3;
AAC02272). {ECO:0000305}.
CONFLICT 2110 2110 F -> Y (in Ref. 3; AAC02272 and 4;
AAF13032). {ECO:0000305}.
CONFLICT 2112 2112 S -> T (in Ref. 3; AAC02272 and 4;
AAF13032). {ECO:0000305}.
CONFLICT 2117 2117 S -> T (in Ref. 3; AAC02272 and 4;
AAF13032). {ECO:0000305}.
CONFLICT 2119 2119 M -> T (in Ref. 3; AAC02272 and 4;
AAF13032). {ECO:0000305}.
CONFLICT 2127 2127 F -> Y (in Ref. 3; AAC02272 and 4;
AAF13032). {ECO:0000305}.
CONFLICT 2129 2129 S -> T (in Ref. 3; AAC02272 and 4;
AAF13032). {ECO:0000305}.
CONFLICT 2136 2138 NAT -> TPS (in Ref. 3; AAC02272 and 4;
AAF13032). {ECO:0000305}.
CONFLICT 2143 2143 N -> S (in Ref. 3; AAC02272 and 4;
AAF13032). {ECO:0000305}.
CONFLICT 2164 2166 LIT -> SIR (in Ref. 3; AAC02272 and 4;
AAF13032). {ECO:0000305}.
CONFLICT 2169 2178 Missing (in Ref. 3; AAC02272 and 4;
AAF13032). {ECO:0000305}.
CONFLICT 2322 2322 H -> R (in Ref. 3; AAC02272 and 4;
AAF13032). {ECO:0000305}.
CONFLICT 2393 2393 T -> P (in Ref. 3; AAC02272).
{ECO:0000305}.
CONFLICT 2956 2956 G -> GC (in Ref. 5; BAB12116).
{ECO:0000305}.
SEQUENCE 3323 AA; 345127 MW; 8C6E21ADD26637EF CRC64;
MQLLGLLGLL WMLKASPWAT GTLSTATSIS QVPFPRAEAA SAVLSNSPHS RDLAGWPLGV
PQLASPAPGH RENAPMTLTT SPHDTLISET LLNSPVSSNT STTPTSKFAF KVETTPPTVL
VYSATTECVY PTSFIITISH PTSICVTTTQ VAFTSSYTST PVTQKPVTTV TSTYSMTTTE
KGTSAMTSSP STTTARETPI VTVTPSSVSA TDTTFHTTIS STTRTTERTP LPTGSIHTTT
SPTPVFTTLK TAVTSTSPIT SSITSTNTVT SMTTTASQPT ATNTLSSPTR TILSSTPVLS
TETITSGITN TTPLSTLVTT LPTTISRSTP TSETTYTTSP TSTVTDSTTK IAYSTSMTGT
LSTETSLPPT SSSLPTTETA TTPMTNLVTT TTEISSHSTP SFSSSTIYST VSTSTTAISS
LPPTSGTMVT STTMTPSSLS TDIPFTTPTT ITHHSVGSTG FLTTATDLTS TFTVSSSSAM
STSVIPSSPS IQNTETSSLV SMTSATTPNV RPTFVSTLST PTSSLLTTFP ATYSFSSSMS
ASSAGTTHTE SISSPPASTS TLHTTAESTL APTTTTSFTT STTMEPPSTT AATTGTGQTT
FTSSTATFPE TTTPTPTTDM STESLTTAMT SPPITSSVTS TNTVTSMTTT TSPPTTTNSF
TSLTSMPLSS TPVPSTEVVT SGTINTIPPS ILVTTLPTPN ASSMTTSETT YPNSPTGPGT
NSTTEITYPT TMTETSSTAT SLPPTSPLVS TAKTAKTPTT NLVTTTTKTT SHSTTSFTSS
TVYSTASTYT TAITSVPTTL GTMVTSTSMI SSTVSTGIPT SQPTTITPSS VGISGSLPMM
TDLTSVYTVS NMSARPTTVI PSSPTVQNTE ISISVSMTSA TTPSGGPTFT STENTPTRSL
LTSFPMTHSF SSSMSESSAG TTHTESISSP RGTTSTLHTT VESTPSPTTT TSFTTSTMME
PPSSTVSTTG RGQTTFPSST ATFPETTTLT PTTDISTVSL TTAMTSPPPV SSSITPTNTM
TSMRTTTYWP TATNTLSPLT SSILSSTPVP STEMITSHTT NTTPLSTLVT TLLTTITRST
PTSETTYPTS PTSIVSDSTT EITYSTSITG TLSTATTLPP TSSSLPTTET ATMTPTTTLI
TTTPNTTSLS TPSFTSSTIY STVSTSTTAI SSASPTSGTM VTSTTMTPSS LSTDTPSTTP
TTITYPSVGS TGFLTTATDL TSTFTVSSSS AMSTSVIPSS PSIQNTETSS LVSMTSATTP
SLRPTITSTD STLTSSLLTT FPSTYSFSSS MSASSAGTTH TETISSLPAS TNTIHTTAES
ALAPTTTTSF TTSPTMEPPS TTVATTGTGQ TTFPSSTATF LETTTLTPTT DFSTESLTTA
MTSTPPITSS ITPTDTMTSM RTTTSWPTAT NTLSPLTSSI LSSTPVPSTE VTTSHTTNTN
PVSTLVTTLP ITITRSTLTS ETAYPSSPTS TVTESTTEIT YPTTMTETSS TATSLPPTSS
LVSTAETAKT PTTNLVTTTT KTTSHSTTSF TSSTIYSTAS TPTTAITSVP TTLGTMVTST
SMIPSTVSTG IPTSQPTTIT PSSVGISGSL PMMTDLTSVY TVSSMSARPT SVIPSSPTVQ
NTETSIFVSM MSATTPSGGP TFTSTENTPT RSLLTSFPVT HSFSSSMSAS SVGTTHTQSI
SSPPAITSTL HTTAESTPSP TTTMSFTTFT KMETPSSTVA TTGTGQTTFT SSTATSPKTT
TLTPTSDIST GSFKTAVSST PPITSSITST YTVTSMTTTT PLGPTATNTL PSFTSSVSSS
TPVPSTEAIT SGTTNTTPLS TLVTTFSNSD TSSTPTSETT YPTSLTSALT DSTTRTTYST
NMTGTLSTVT SLRPTSSSLL TTVTATVPTT NLVTTTTKIT SHSTPSFTSS IATTETPSHS
TPRFTSSITT TETPSHSTPR FTSSITNTKT TSHSSPSFTS SITTTETTSH NTPSLTSSIT
TTKTTSHSTP SYTSLITTTT TTSHSTPSFT SSITTTETTS HNTPSLTSSI TTTETTSHST
PSFTSSITTE TTSHSTPSFT SLITITEITS HSTLSYTTSI TTTETPSHST LSFTSSITTT
ETTSHSTPSF TSSITTSEMP SHSTPSFTSS ITTTENATHS TPNFTSSITT TETTSHSTPS
FTSLITTTET TSHRWGTTET TSYSTPSFTS SNTITETTSH STPSYITSIT TTETPSSSTP
SFSSSITTTE TTSHSTPGFT SSITTTETTS HSTPSFTSSI TTTETTSHDT PSFTSSITTS
ETPSHSTPSS TSLITTTKTT SHSTPSFTSS ITTTETTSHS AHSFTSSITT TETTSHNTRS
FTSSITTTET NSHSTTSFTS SITTTETTSH STPSFSSSIT TTETPLHSTP GLTSWVTTTK
TTSHITPGLT SSITTTETTS HSTPGFTSSI TTTETTSEST PSLSSSTIYS TVSTSTTAIT
SHFTTSETAV TPTPVTPSSL STDIPTTSLR TLTPSSVGTS TSLTTTTDFP SIPTDISTLP
TRTHIISSSP SIQSTETSSL VGTTSPTMST VRMTLRITEN TPISSFSTSI VVIPETPTQT
PPVLTSATGT QTSPAPTTVT FGSTDSSTST LHTLTPSTAL STIVSTSQVP IPSTHSSTLQ
TTPSTPSLQT SLTSTSEFTT ESFTRGSTST NAILTSFSTI IWSSTPTIIM SSSPSSASIT
PVFSTTIHSV PSSPYIFSTE NVGSASITGF PSLSSSATTS TSSTSSSLTT ALTEITPFSY
ISLPSTTPCP GTITITIVPA SPTDPCVEMD PSTEATSPPT TPLTVFPFTT EMVTCPTSIS
IQTTLTTYMD TSSMMPESES SISPNASSST GTGTVPTNTV FTSTRLPTSE TWLSNSSVIP
LPLPGVSTIP LTMKPSSSLP TILRTSSKST HPSPPTTRTS ETPVATTQTP TTLTSRRTTR
ITSQMTTQST LTTTAGTCDN GGTWEQGQCA CLPGFSGDRC QLQTRCQNGG QWDGLKCQCP
STFYGSSCEF AVEQVDLDVV ETEVGMEVSV DQQFSPDLND NTSQAYRDFN KTFWNQMQKI
FADMQGFTFK GVEILSLRNG SIVVDYLVLL EMPFSPQLES EYEQVKTTLK EGLQNASQDV
NSCQDSQTLC FKPDSIKVNN NSKTELTPAA ICRRAAPTGY EEFYFPLVEA TRLRCVTKCT
SGVDNAIDCH QGQCVLETSG PTCRCYSTDT HWFSGPRCEV AVHWRALVGG LTAGAALLVL
LLLALGVRAV RSGWWGGQRR GRSWDQDRKW FETWDEEVVG TFSNWGFEDD GTDKDTNFYV
ALENVDTTMK VHIKRPEMTS SSV


Related products :

Catalog number Product name Quantity
E0684h ELISA Cervical mucin,High molecular weight salivary mucin MG1,Homo sapiens,Human,MUC5,MUC5B,MUC-5B,Mucin-5 subtype B, tracheobronchial,Mucin-5B,Sublingual gland mucin 96T
E0684h ELISA kit Cervical mucin,High molecular weight salivary mucin MG1,Homo sapiens,Human,MUC5,MUC5B,MUC-5B,Mucin-5 subtype B, tracheobronchial,Mucin-5B,Sublingual gland mucin 96T
U0684h CLIA Cervical mucin,High molecular weight salivary mucin MG1,Homo sapiens,Human,MUC5,MUC5B,MUC-5B,Mucin-5 subtype B, tracheobronchial,Mucin-5B,Sublingual gland mucin 96T
U1034h CLIA Ascites sialoglycoprotein,ASGP,Homo sapiens,Human,MUC4,MUC-4,Mucin-4,Pancreatic adenocarcinoma mucin,Testis mucin,Tracheobronchial mucin 96T
E1034h ELISA kit Ascites sialoglycoprotein,ASGP,Homo sapiens,Human,MUC4,MUC-4,Mucin-4,Pancreatic adenocarcinoma mucin,Testis mucin,Tracheobronchial mucin 96T
E1034h ELISA Ascites sialoglycoprotein,ASGP,Homo sapiens,Human,MUC4,MUC-4,Mucin-4,Pancreatic adenocarcinoma mucin,Testis mucin,Tracheobronchial mucin 96T
U0705r CLIA Intestinal mucin-2,Muc2,MUC-2,Mucin-2,Rat,Rattus norvegicus 96T
E0705r ELISA Intestinal mucin-2,Muc2,MUC-2,Mucin-2,Rat,Rattus norvegicus 96T
E0705r ELISA kit Intestinal mucin-2,Muc2,MUC-2,Mucin-2,Rat,Rattus norvegicus 96T
EIAAB25814 Homo sapiens,Human,Intestinal mucin-3B,MUC3B,MUC-3B,Mucin-3B
E1031h ELISA Homo sapiens,Human,Intestinal mucin-3A,MUC3,MUC3A,MUC-3A,Mucin-3A 96T
U0705h CLIA Homo sapiens,Human,Intestinal mucin-2,MUC2,MUC-2,Mucin-2,SMUC 96T
E1031h ELISA kit Homo sapiens,Human,Intestinal mucin-3A,MUC3,MUC3A,MUC-3A,Mucin-3A 96T
E0705h ELISA Homo sapiens,Human,Intestinal mucin-2,MUC2,MUC-2,Mucin-2,SMUC 96T
E0705h ELISA kit Homo sapiens,Human,Intestinal mucin-2,MUC2,MUC-2,Mucin-2,SMUC 96T
U1031h CLIA Homo sapiens,Human,Intestinal mucin-3A,MUC3,MUC3A,MUC-3A,Mucin-3A 96T
U0403h CLIA Homo sapiens,Human,MUC17,MUC-17,MUC3,MUC-3,Mucin-17,Small intestinal mucin-3 96T
E0403h ELISA Homo sapiens,Human,MUC17,MUC-17,MUC3,MUC-3,Mucin-17,Small intestinal mucin-3 96T
E0403h ELISA kit Homo sapiens,Human,MUC17,MUC-17,MUC3,MUC-3,Mucin-17,Small intestinal mucin-3 96T
20-783-72954 MOUSE ANTI HUMAN MUCIN 5AC - MUC-5AC; Mucin-5 subtype AC. tracheobronchial; Tracheobronchial mucin; TBM; Major airway glycoprotein; Gastric mucin; Lewis B blood group antigen; LeB Monoclonal 0.2 mg
E0756h ELISA kit Gastric mucin,Homo sapiens,Human,LeB,Lewis B blood group antigen,Major airway glycoprotein,MUC5,MUC5AC,MUC-5AC,Mucin-5 subtype AC, tracheobronchial,Mucin-5AC,TBM,Tracheobronchial mucin 96T
E0413h ELISA Breast carcinoma-associated antigen DF3,Carcinoma-associated mucin,EMA,Episialin,H23AG,Homo sapiens,Human,MUC1,MUC-1,Mucin-1,Peanut-reactive urinary mucin,PEM,PEMT,Polymorphic epithelial mucin,P 96T
U0413h CLIA Breast carcinoma-associated antigen DF3,Carcinoma-associated mucin,EMA,Episialin,H23AG,Homo sapiens,Human,MUC1,MUC-1,Mucin-1,Peanut-reactive urinary mucin,PEM,PEMT,Polymorphic epithelial mucin,PU 96T
U0756h CLIA Gastric mucin,Homo sapiens,Human,LeB,Lewis B blood group antigen,Major airway glycoprotein,MUC5,MUC5AC,MUC-5AC,Mucin-5 subtype AC, tracheobronchial,Mucin-5AC,TBM,Tracheobronchial mucin 96T
E0756h ELISA Gastric mucin,Homo sapiens,Human,LeB,Lewis B blood group antigen,Major airway glycoprotein,MUC5,MUC5AC,MUC-5AC,Mucin-5 subtype AC, tracheobronchial,Mucin-5AC,TBM,Tracheobronchial mucin 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur