Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Myelin-oligodendrocyte glycoprotein

 MOG_HUMAN               Reviewed;         247 AA.
Q16653; A6NDR4; A6NNJ9; A8MY31; B0UZR9; E9PGF0; F8W9D5; O00713;
O00714; O00715; Q13054; Q13055; Q14855; Q29ZN8; Q56UY0; Q5JNX7;
Q5JNY1; Q5JNY2; Q5JNY4; Q5SSB5; Q5SSB6; Q5STL9; Q5STM0; Q5STM1;
Q5STM2; Q5STM5; Q5SUK5; Q5SUK7; Q5SUK8; Q5SUK9; Q5SUL0; Q5SUL1;
Q8IYG5; Q92891; Q92892; Q92893; Q92894; Q92895; Q93053; Q96KU9;
Q96KV0; Q96KV1; Q99605;
01-NOV-1997, integrated into UniProtKB/Swiss-Prot.
11-JAN-2011, sequence version 2.
25-OCT-2017, entry version 159.
RecName: Full=Myelin-oligodendrocyte glycoprotein;
Flags: Precursor;
Name=MOG;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, AND VARIANT VAL-174.
PubMed=7790876;
Hilton A.A., Slavin A.J., Hilton D.J., Bernard C.C.A.;
"Characterization of cDNA and genomic clones encoding human myelin
oligodendrocyte glycoprotein.";
J. Neurochem. 65:309-318(1995).
[2]
NUCLEOTIDE SEQUENCE [MRNA], AND VARIANT VAL-174.
TISSUE=Brain;
PubMed=7964757;
Pham-Dinh D., Allinquant B., Ruberg M., della Gaspera B.,
Nussbaum J.-L., Dautigny A.;
"Characterization and expression of the cDNA coding for the human
myelin/oligodendrocyte glycoprotein.";
J. Neurochem. 63:2353-2356(1994).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS LEU-171 AND VAL-174.
PubMed=8530032; DOI=10.1006/geno.1995.1137;
Roth M.-P., Malfroy L., Offer C., Sevin J., Enault G., Borot N.,
Pontarotti P., Coppin H.;
"The human myelin oligodendrocyte glycoprotein (MOG) gene: complete
nucleotide sequence and structural characterization.";
Genomics 28:241-250(1995).
[4]
NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, AND VARIANT VAL-174.
PubMed=8666381; DOI=10.1006/geno.1995.9995;
Pham-Dinh D., Della Gaspera B., de Rosbo N.K., Dautigny A.;
"Structure of the human myelin/oligodendrocyte glycoprotein gene and
multiple alternative spliced isoforms.";
Genomics 29:345-352(1995).
[5]
NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, NUCLEOTIDE SEQUENCE
[MRNA] OF 30-247 (ISOFORM 10), AND VARIANT VAL-174.
PubMed=8915905;
DOI=10.1002/(SICI)1097-4547(19961015)46:2<271::AID-JNR16>3.0.CO;2-5;
Ballenthin P.A., Gardinier M.V.;
"Myelin/oligodendrocyte glycoprotein is alternatively spliced in
humans but not mice.";
J. Neurosci. Res. 46:271-281(1996).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
VAL-174.
TISSUE=Brain cortex;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], AND VARIANTS LEU-171
AND VAL-174.
PubMed=14574404; DOI=10.1038/nature02055;
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L.,
Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E.,
Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R.,
Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S.,
Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J.,
Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P.,
Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y.,
Burford D.C., Burrill W., Burton J., Carder C., Carter N.P.,
Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V.,
Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J.,
Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E.,
Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A.,
Frankland J., French L., Garner P., Garnett J., Ghori M.J.,
Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M.,
Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S.,
Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R.,
Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E.,
Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A.,
Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C.,
Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M.,
Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M.,
Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K.,
McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T.,
Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R.,
Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W.,
Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M.,
Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L.,
Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J.,
Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B.,
Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L.,
Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W.,
Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A.,
Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.;
"The DNA sequence and analysis of human chromosome 6.";
Nature 425:805-811(2003).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], AND VARIANT VAL-174.
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 13), AND VARIANT
VAL-174.
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[10]
NUCLEOTIDE SEQUENCE [MRNA] OF 3-206 (ISOFORM 11), NUCLEOTIDE SEQUENCE
[MRNA] OF 3-108 (ISOFORM 12), ALTERNATIVE SPLICING, AND VARIANT
VAL-174.
Delarasse C., Della Gaspera B., Genain C., Pham-Dinh D.;
"Alternative splicing of the MOG gene across species.";
Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases.
[11]
FUNCTION (MICROBIAL INFECTION), AND INTERACTION WITH RUBELLA VIRUS E2
GLYCOPROTEIN.
PubMed=21880773; DOI=10.1128/JVI.05398-11;
Cong H., Jiang Y., Tien P.;
"Identification of the myelin oligodendrocyte glycoprotein as a
cellular receptor for rubella virus.";
J. Virol. 85:11038-11047(2011).
[12]
STRUCTURE BY NMR OF 64-84.
PubMed=9210466; DOI=10.1111/j.1432-1033.1997.t01-2-00059.x;
Albouz-Abo S., Wilson J.C., Bernard C.C.A., von Itzstein M.;
"A conformational study of the human and rat encephalitogenic myelin
oligodendrocyte glycoprotein peptides 35-55.";
Eur. J. Biochem. 246:59-70(1997).
[13]
VARIANT NRCLP7 CYS-133.
PubMed=21907016; DOI=10.1016/j.ajhg.2011.08.007;
Hor H., Bartesaghi L., Kutalik Z., Vicario J.L., de Andres C.,
Pfister C., Lammers G.J., Guex N., Chrast R., Tafti M.,
Peraita-Adrados R.;
"A missense mutation in myelin oligodendrocyte glycoprotein as a cause
of familial narcolepsy with cataplexy.";
Am. J. Hum. Genet. 89:474-479(2011).
-!- FUNCTION: Mediates homophilic cell-cell adhesion (By similarity).
Minor component of the myelin sheath. May be involved in
completion and/or maintenance of the myelin sheath and in cell-
cell communication. {ECO:0000250}.
-!- FUNCTION: (Microbial infection) Acts as a receptor for rubella
virus. {ECO:0000269|PubMed:21880773}.
-!- SUBUNIT: Homodimer (By similarity). May form heterodimers between
the different isoforms (By similarity). {ECO:0000250}.
-!- SUBUNIT: (Microbial infection) Interacts with rubella virus E2
glycoprotein. {ECO:0000269|PubMed:21880773}.
-!- SUBCELLULAR LOCATION: Isoform 1: Cell membrane {ECO:0000305};
Multi-pass membrane protein {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 5: Cell membrane {ECO:0000305};
Multi-pass membrane protein {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 2: Cell membrane {ECO:0000305};
Single-pass type I membrane protein {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 3: Cell membrane {ECO:0000305};
Single-pass type I membrane protein {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 4: Cell membrane {ECO:0000305};
Single-pass type I membrane protein {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 6: Cell membrane {ECO:0000305};
Single-pass type I membrane protein {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 7: Cell membrane {ECO:0000305};
Single-pass type I membrane protein {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 8: Cell membrane {ECO:0000305};
Single-pass type I membrane protein {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 9: Cell membrane {ECO:0000305};
Single-pass type I membrane protein {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=13;
Comment=Additional isoforms seem to exist.;
Name=1; Synonyms=Alpha-1;
IsoId=Q16653-1; Sequence=Displayed;
Name=2; Synonyms=Alpha-2;
IsoId=Q16653-2; Sequence=VSP_002543;
Name=3; Synonyms=Alpha-3;
IsoId=Q16653-3; Sequence=VSP_002542;
Name=4; Synonyms=Alpha-4;
IsoId=Q16653-4; Sequence=VSP_002539;
Name=5; Synonyms=Beta-1;
IsoId=Q16653-5; Sequence=VSP_002545;
Name=6; Synonyms=Beta-2;
IsoId=Q16653-6; Sequence=VSP_002543, VSP_002545;
Name=7; Synonyms=Beta-3;
IsoId=Q16653-7; Sequence=VSP_002542, VSP_002545;
Name=8; Synonyms=Beta-4;
IsoId=Q16653-8; Sequence=VSP_002544, VSP_002545;
Name=9;
IsoId=Q16653-9; Sequence=VSP_002540, VSP_002541;
Note=Not functionally active. May be expressed at low level in
the adult.;
Name=10;
IsoId=Q16653-10; Sequence=VSP_040344, VSP_040345;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
Name=11;
IsoId=Q16653-11; Sequence=VSP_046856;
Name=12;
IsoId=Q16653-12; Sequence=VSP_002539, VSP_002542;
Name=13; Synonyms=X1;
IsoId=Q16653-13; Sequence=VSP_055600;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Found exclusively in the CNS, where it is
localized on the surface of myelin and oligodendrocyte cytoplasmic
membranes.
-!- DISEASE: Narcolepsy 7 (NRCLP7) [MIM:614250]: Neurological
disabling sleep disorder, characterized by excessive daytime
sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-
movement (REM) sleep, cataplexy, hypnagogic hallucinations, and
sleep paralysis. Cataplexy is a sudden loss of muscle tone
triggered by emotions, which is the most valuable clinical feature
used to diagnose narcolepsy. Human narcolepsy is primarily a
sporadically occurring disorder but familial clustering has been
observed. {ECO:0000269|PubMed:21907016}. Note=The disease is
caused by mutations affecting the gene represented in this entry.
-!- SIMILARITY: Belongs to the immunoglobulin superfamily. BTN/MOG
family. {ECO:0000305}.
-!- CAUTION: Do not confuse myelin-oligodendrocyte glycoprotein (MOG)
with oligodendrocyte-myelin glycoprotein (OMG). {ECO:0000305}.
-!- WEB RESOURCE: Name=Wikipedia; Note=Myelin oligodendrocyte
glycoprotein entry;
URL="https://en.wikipedia.org/wiki/Myelin_oligodendrocyte_glycoprotein";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; X74511; CAA52617.1; -; mRNA.
EMBL; Z48051; CAA88109.1; -; Genomic_DNA.
EMBL; U18840; AAC50361.1; -; mRNA.
EMBL; U18843; AAC50362.1; -; mRNA.
EMBL; U18798; AAC50876.1; -; mRNA.
EMBL; U18799; AAC50877.1; -; mRNA.
EMBL; U18800; AAB36870.1; -; mRNA.
EMBL; U18801; AAC50878.1; -; mRNA.
EMBL; U18803; AAC50879.1; -; mRNA.
EMBL; U64564; AAB08088.1; -; mRNA.
EMBL; U64565; AAB08089.1; -; mRNA.
EMBL; U64566; AAB08090.1; -; mRNA.
EMBL; U64567; AAB08091.1; -; mRNA.
EMBL; U64568; AAB08092.1; -; mRNA.
EMBL; U64569; AAB08093.1; -; mRNA.
EMBL; U64570; AAB08094.1; -; mRNA.
EMBL; U64571; AAB08095.1; -; mRNA.
EMBL; AK312892; BAG35739.1; -; mRNA.
EMBL; AL050328; CAB89267.1; -; Genomic_DNA.
EMBL; AL050328; CAB89268.1; -; Genomic_DNA.
EMBL; AL050328; CAB89269.1; -; Genomic_DNA.
EMBL; AL050328; CAB89270.1; -; Genomic_DNA.
EMBL; AL050328; CAB89271.1; -; Genomic_DNA.
EMBL; AL662826; CAI17395.2; -; Genomic_DNA.
EMBL; AL662826; CAI17396.1; -; Genomic_DNA.
EMBL; AL669813; CAI17396.1; JOINED; Genomic_DNA.
EMBL; AL662826; CAI17397.1; -; Genomic_DNA.
EMBL; AL669813; CAI17397.1; JOINED; Genomic_DNA.
EMBL; AL662826; CAI17400.3; -; Genomic_DNA.
EMBL; AL669813; CAI17636.2; -; Genomic_DNA.
EMBL; AL662826; CAI17636.2; JOINED; Genomic_DNA.
EMBL; AL669813; CAI17637.1; -; Genomic_DNA.
EMBL; AL662826; CAI17637.1; JOINED; Genomic_DNA.
EMBL; AL645936; CAI18020.1; -; Genomic_DNA.
EMBL; AL645936; CAI18021.1; -; Genomic_DNA.
EMBL; AL645936; CAI18022.2; -; Genomic_DNA.
EMBL; AL645936; CAI18023.1; -; Genomic_DNA.
EMBL; AL645936; CAI18024.1; -; Genomic_DNA.
EMBL; AL929591; CAI41911.2; -; Genomic_DNA.
EMBL; AL929591; CAI41914.2; -; Genomic_DNA.
EMBL; AL929591; CAI41917.1; -; Genomic_DNA.
EMBL; BX120002; CAI95560.2; -; Genomic_DNA.
EMBL; BX120002; CAI95564.1; -; Genomic_DNA.
EMBL; BX120002; CAI95565.1; -; Genomic_DNA.
EMBL; BX120002; CAI95568.2; -; Genomic_DNA.
EMBL; AL929591; CAM25818.1; -; Genomic_DNA.
EMBL; CR759766; CAQ06614.1; -; Genomic_DNA.
EMBL; CR388408; CAQ08208.1; -; Genomic_DNA.
EMBL; CR388408; CAQ08210.1; -; Genomic_DNA.
EMBL; CR388408; CAQ08212.1; -; Genomic_DNA.
EMBL; CR388408; CAQ08213.1; -; Genomic_DNA.
EMBL; CR936483; CAQ10086.1; -; Genomic_DNA.
EMBL; CR936483; CAQ10088.1; -; Genomic_DNA.
EMBL; CR936483; CAQ10090.1; -; Genomic_DNA.
EMBL; CR936483; CAQ10091.1; -; Genomic_DNA.
EMBL; BX927250; CAQ10709.1; -; Genomic_DNA.
EMBL; BX927250; CAQ10711.1; -; Genomic_DNA.
EMBL; BX927250; CAQ10713.1; -; Genomic_DNA.
EMBL; BX927250; CAQ10714.1; -; Genomic_DNA.
EMBL; CH471081; EAX03213.1; -; Genomic_DNA.
EMBL; CH471081; EAX03214.1; -; Genomic_DNA.
EMBL; CH471081; EAX03216.1; -; Genomic_DNA.
EMBL; CH471081; EAX03217.1; -; Genomic_DNA.
EMBL; BC035938; AAH35938.1; -; mRNA.
EMBL; AY566847; AAU09338.1; -; mRNA.
EMBL; AY566853; AAU09343.1; -; mRNA.
CCDS; CCDS34366.1; -. [Q16653-7]
CCDS; CCDS34367.1; -. [Q16653-6]
CCDS; CCDS34368.1; -. [Q16653-11]
CCDS; CCDS34369.1; -. [Q16653-3]
CCDS; CCDS34370.1; -. [Q16653-1]
CCDS; CCDS4667.1; -. [Q16653-5]
CCDS; CCDS47394.1; -. [Q16653-2]
CCDS; CCDS47395.2; -. [Q16653-4]
CCDS; CCDS54977.1; -. [Q16653-12]
PIR; S58394; S58394.
RefSeq; NP_001008229.1; NM_001008228.2. [Q16653-3]
RefSeq; NP_001008230.1; NM_001008229.2. [Q16653-11]
RefSeq; NP_001163889.1; NM_001170418.1. [Q16653-12]
RefSeq; NP_002424.3; NM_002433.4. [Q16653-5]
RefSeq; NP_996532.2; NM_206809.3. [Q16653-1]
RefSeq; NP_996533.2; NM_206810.3. [Q16653-6]
RefSeq; NP_996534.2; NM_206811.3. [Q16653-7]
RefSeq; NP_996535.2; NM_206812.3. [Q16653-2]
RefSeq; NP_996537.3; NM_206814.5. [Q16653-4]
RefSeq; XP_005249188.1; XM_005249131.3. [Q16653-13]
UniGene; Hs.141308; -.
PDB; 1Q70; Model; -; A=31-149.
PDBsum; 1Q70; -.
ProteinModelPortal; Q16653; -.
SMR; Q16653; -.
BioGrid; 110482; 1.
IntAct; Q16653; 1.
STRING; 9606.ENSP00000366095; -.
iPTMnet; Q16653; -.
PhosphoSitePlus; Q16653; -.
SwissPalm; Q16653; -.
BioMuta; MOG; -.
DMDM; 317373391; -.
PaxDb; Q16653; -.
PeptideAtlas; Q16653; -.
PRIDE; Q16653; -.
DNASU; 4340; -.
Ensembl; ENST00000259891; ENSP00000259891; ENSG00000137345.
Ensembl; ENST00000359539; ENSP00000352534; ENSG00000137345.
Ensembl; ENST00000376888; ENSP00000366085; ENSG00000204655. [Q16653-4]
Ensembl; ENST00000376891; ENSP00000366088; ENSG00000204655. [Q16653-11]
Ensembl; ENST00000376894; ENSP00000366091; ENSG00000204655. [Q16653-13]
Ensembl; ENST00000376898; ENSP00000366095; ENSG00000204655. [Q16653-5]
Ensembl; ENST00000376917; ENSP00000366115; ENSG00000204655. [Q16653-1]
Ensembl; ENST00000383521; ENSP00000373013; ENSG00000237834.
Ensembl; ENST00000383525; ENSP00000373017; ENSG00000237834.
Ensembl; ENST00000383630; ENSP00000373126; ENSG00000137345.
Ensembl; ENST00000383631; ENSP00000373127; ENSG00000137345.
Ensembl; ENST00000396701; ENSP00000379929; ENSG00000204655. [Q16653-6]
Ensembl; ENST00000396704; ENSP00000379932; ENSG00000204655. [Q16653-3]
Ensembl; ENST00000400669; ENSP00000383510; ENSG00000237834.
Ensembl; ENST00000400671; ENSP00000383512; ENSG00000237834.
Ensembl; ENST00000400688; ENSP00000383526; ENSG00000137345.
Ensembl; ENST00000400691; ENSP00000383528; ENSG00000137345.
Ensembl; ENST00000412760; ENSP00000404245; ENSG00000237834.
Ensembl; ENST00000414889; ENSP00000403380; ENSG00000234623.
Ensembl; ENST00000415546; ENSP00000404149; ENSG00000234096.
Ensembl; ENST00000417019; ENSP00000404537; ENSG00000234096.
Ensembl; ENST00000419274; ENSP00000411489; ENSG00000236561.
Ensembl; ENST00000419309; ENSP00000395005; ENSG00000236561.
Ensembl; ENST00000420045; ENSP00000390682; ENSG00000234096.
Ensembl; ENST00000423895; ENSP00000390632; ENSG00000230885.
Ensembl; ENST00000425145; ENSP00000397101; ENSG00000234623.
Ensembl; ENST00000426782; ENSP00000410699; ENSG00000230885.
Ensembl; ENST00000427289; ENSP00000414489; ENSG00000230885.
Ensembl; ENST00000428719; ENSP00000397723; ENSG00000234096.
Ensembl; ENST00000430264; ENSP00000403058; ENSG00000234623.
Ensembl; ENST00000430351; ENSP00000410268; ENSG00000234096.
Ensembl; ENST00000431798; ENSP00000410866; ENSG00000204655. [Q16653-2]
Ensembl; ENST00000432271; ENSP00000389221; ENSG00000234623.
Ensembl; ENST00000433500; ENSP00000413364; ENSG00000236561.
Ensembl; ENST00000434177; ENSP00000398197; ENSG00000234623.
Ensembl; ENST00000438803; ENSP00000414862; ENSG00000236561.
Ensembl; ENST00000439634; ENSP00000404957; ENSG00000234096.
Ensembl; ENST00000439884; ENSP00000398394; ENSG00000237834.
Ensembl; ENST00000440561; ENSP00000409534; ENSG00000230885.
Ensembl; ENST00000442244; ENSP00000391516; ENSG00000236561.
Ensembl; ENST00000442444; ENSP00000414146; ENSG00000137345.
Ensembl; ENST00000442629; ENSP00000399240; ENSG00000234623.
Ensembl; ENST00000444674; ENSP00000390469; ENSG00000230885.
Ensembl; ENST00000447285; ENSP00000401609; ENSG00000236561.
Ensembl; ENST00000448816; ENSP00000397837; ENSG00000237834.
Ensembl; ENST00000449096; ENSP00000391898; ENSG00000234096.
Ensembl; ENST00000452233; ENSP00000394873; ENSG00000234623.
Ensembl; ENST00000452744; ENSP00000389022; ENSG00000232641.
Ensembl; ENST00000457090; ENSP00000415883; ENSG00000236561.
Ensembl; ENST00000457626; ENSP00000402139; ENSG00000230885.
Ensembl; ENST00000458179; ENSP00000413370; ENSG00000230885.
Ensembl; ENST00000490427; ENSP00000420350; ENSG00000204655. [Q16653-12]
Ensembl; ENST00000494692; ENSP00000417405; ENSG00000204655. [Q16653-7]
Ensembl; ENST00000547083; ENSP00000449213; ENSG00000137345.
Ensembl; ENST00000548017; ENSP00000448732; ENSG00000234096.
Ensembl; ENST00000550849; ENSP00000449683; ENSG00000237834.
Ensembl; ENST00000551175; ENSP00000448879; ENSG00000234623.
Ensembl; ENST00000551993; ENSP00000446871; ENSG00000230885.
Ensembl; ENST00000553111; ENSP00000447099; ENSG00000236561.
GeneID; 4340; -.
KEGG; hsa:4340; -.
UCSC; uc003nmy.3; human. [Q16653-1]
CTD; 4340; -.
DisGeNET; 4340; -.
EuPathDB; HostDB:ENSG00000204655.11; -.
GeneCards; MOG; -.
H-InvDB; HIX0025082; -.
H-InvDB; HIX0058179; -.
H-InvDB; HIX0166437; -.
H-InvDB; HIX0166689; -.
H-InvDB; HIX0166922; -.
H-InvDB; HIX0167201; -.
H-InvDB; HIX0167440; -.
HGNC; HGNC:7197; MOG.
HPA; HPA021873; -.
MalaCards; MOG; -.
MIM; 159465; gene.
MIM; 614250; phenotype.
neXtProt; NX_Q16653; -.
OpenTargets; ENSG00000204655; -.
Orphanet; 2073; Narcolepsy-cataplexy.
PharmGKB; PA30905; -.
eggNOG; ENOG410IKKW; Eukaryota.
eggNOG; ENOG41119UE; LUCA.
GeneTree; ENSGT00760000118933; -.
HOGENOM; HOG000213934; -.
HOVERGEN; HBG004565; -.
InParanoid; Q16653; -.
KO; K17270; -.
OrthoDB; EOG091G0JF2; -.
PhylomeDB; Q16653; -.
TreeFam; TF331083; -.
ChiTaRS; MOG; human.
GeneWiki; Myelin_oligodendrocyte_glycoprotein; -.
GenomeRNAi; 4340; -.
PRO; PR:Q16653; -.
Proteomes; UP000005640; Chromosome 6.
Bgee; ENSG00000204655; -.
ExpressionAtlas; Q16653; baseline and differential.
Genevisible; Q16653; HS.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005886; C:plasma membrane; NAS:ProtInc.
GO; GO:0001618; F:virus receptor activity; IEA:UniProtKB-KW.
GO; GO:0007155; P:cell adhesion; IEA:UniProtKB-KW.
GO; GO:0007417; P:central nervous system development; TAS:ProtInc.
Gene3D; 2.60.40.10; -; 1.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003599; Ig_sub.
InterPro; IPR013106; Ig_V-set.
InterPro; IPR016663; Myelin-oligodendrocyte_glycop.
Pfam; PF07686; V-set; 1.
PIRSF; PIRSF016522; MOG; 1.
SMART; SM00409; IG; 1.
SMART; SM00406; IGv; 1.
SUPFAM; SSF48726; SSF48726; 1.
PROSITE; PS50835; IG_LIKE; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Cell adhesion; Cell membrane;
Complete proteome; Disease mutation; Disulfide bond; Glycoprotein;
Host cell receptor for virus entry; Host-virus interaction;
Immunoglobulin domain; Membrane; Polymorphism; Receptor;
Reference proteome; Signal; Transmembrane; Transmembrane helix.
SIGNAL 1 29 {ECO:0000255}.
CHAIN 30 247 Myelin-oligodendrocyte glycoprotein.
/FTId=PRO_0000014888.
TOPO_DOM 30 154 Extracellular. {ECO:0000255}.
TRANSMEM 155 175 Helical. {ECO:0000255}.
TOPO_DOM 176 210 Cytoplasmic. {ECO:0000255}.
TRANSMEM 211 231 Helical. {ECO:0000255}.
TOPO_DOM 232 247 Extracellular. {ECO:0000255}.
DOMAIN 32 145 Ig-like V-type.
CARBOHYD 60 60 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 53 127 {ECO:0000255|PROSITE-ProRule:PRU00114}.
VAR_SEQ 30 145 Missing (in isoform 4 and isoform 12).
{ECO:0000303|Ref.10}.
/FTId=VSP_002539.
VAR_SEQ 146 171 DPFYWVSPGVLVLLAVLPVLLLQITV -> VSHSVTQDWLQ
WHDHGSLQPPPPRLK (in isoform 10).
{ECO:0000303|PubMed:8915905}.
/FTId=VSP_040344.
VAR_SEQ 172 247 Missing (in isoform 10).
{ECO:0000303|PubMed:8915905}.
/FTId=VSP_040345.
VAR_SEQ 198 247 DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQ
FLEELRNPF -> VFHLEALSG (in isoform 11).
{ECO:0000303|Ref.10}.
/FTId=VSP_046856.
VAR_SEQ 198 243 Missing (in isoform 8). {ECO:0000305}.
/FTId=VSP_002544.
VAR_SEQ 198 236 Missing (in isoform 2 and isoform 6).
{ECO:0000305}.
/FTId=VSP_002543.
VAR_SEQ 198 236 DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA
-> ESFGVLGPQVKEPKKT (in isoform 3,
isoform 7 and isoform 12).
{ECO:0000303|Ref.10}.
/FTId=VSP_002542.
VAR_SEQ 198 203 DPHFLR -> GKFRHV (in isoform 9).
{ECO:0000305}.
/FTId=VSP_002540.
VAR_SEQ 204 247 Missing (in isoform 9). {ECO:0000305}.
/FTId=VSP_002541.
VAR_SEQ 244 247 RNPF -> LFHLEALSG (in isoform 5, isoform
6, isoform 7 and isoform 8).
{ECO:0000305}.
/FTId=VSP_002545.
VAR_SEQ 245 247 NPF -> KFSSLCYKQRIKSQERETEATRGRGGLLRDHIPR
GKEELESLGGGKTPPGR (in isoform 13).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_055600.
VARIANT 133 133 S -> C (in NRCLP7; dbSNP:rs387906655).
{ECO:0000269|PubMed:21907016}.
/FTId=VAR_066415.
VARIANT 171 171 V -> L (in dbSNP:rs2857766).
{ECO:0000269|PubMed:14574404,
ECO:0000269|PubMed:8530032}.
/FTId=VAR_056056.
VARIANT 174 174 I -> V (in dbSNP:rs3130253).
{ECO:0000269|PubMed:14574404,
ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:7790876,
ECO:0000269|PubMed:7964757,
ECO:0000269|PubMed:8530032,
ECO:0000269|PubMed:8666381,
ECO:0000269|PubMed:8915905,
ECO:0000269|Ref.10, ECO:0000269|Ref.8}.
/FTId=VAR_060215.
SEQUENCE 247 AA; 28193 MW; 846EBA5D412C080C CRC64;
MASLSRPSLP SCLCSFLLLL LLQVSSSYAG QFRVIGPRHP IRALVGDEVE LPCRISPGKN
ATGMEVGWYR PPFSRVVHLY RNGKDQDGDQ APEYRGRTEL LKDAIGEGKV TLRIRNVRFS
DEGGFTCFFR DHSYQEEAAM ELKVEDPFYW VSPGVLVLLA VLPVLLLQIT VGLIFLCLQY
RLRGKLRAEI ENLHRTFDPH FLRVPCWKIT LFVIVPVLGP LVALIICYNW LHRRLAGQFL
EELRNPF


Related products :

Catalog number Product name Quantity
orb81219 Myelin Oligodendrocyte Glycoprotein Myelin Oligodendrocyte Glycoprotein is a single, non-glycosylated polypeptide chain containing 21 amino acids and having a molecular mass of 2582 Dalton, the molecu 5 mg
orb81220 Human Myelin Oligodendrocyte Glycoprotein Myelin Oligodendrocyte Glycoprotein produced in E.coli is a single, non-glycosylated polypeptide chain containing 132 amino acids and having a molecular mass 10
pro-371 Myelin Oligodendrocyte Glycoprotein 100mg
PRO-371 Myelin Oligodendrocyte Glycoprotein 25mg
RPR-371 Myelin Oligodendrocyte Glycoprotein 5mg
PRO-371 Myelin Oligodendrocyte Glycoprotein 100mg
pro-371 Myelin Oligodendrocyte Glycoprotein MOG 5mg
pro-371 Myelin Oligodendrocyte Glycoprotein MOG 25mg
PRO-371 Myelin Oligodendrocyte Glycoprotein 5mg
pro-371 Myelin Oligodendrocyte Glycoprotein MOG 100mg
RP17237160100 Myelin Oligodendrocyte Glycoprotein 100 mg
GTX75606 Myelin oligodendrocyte glycoprotein 200 µg
228-11133-2 Myelin Oligodendrocyte Glycoprotein 25 mg
OETPRO371 Myelin Oligodendrocyte Glycoprotein 25mg
228-11133-3 Myelin Oligodendrocyte Glycoprotein 100 mg
RP17246630050 Myelin Oligodendrocyte Glycoprotein 50 µg
OETPRO371 Myelin Oligodendrocyte Glycoprotein 5mg
GTX75606 Myelin oligodendrocyte glycoprotein 200 µg
7-05615 Myelin Oligodendrocyte Glycoprotein 25mg
RP17246660001 Myelin Oligodendrocyte Glycoprotein 1 mg
7-05614 Myelin Oligodendrocyte Glycoprotein 5mg
RP17246630010 Myelin Oligodendrocyte Glycoprotein 10 µg
Z5010094 Myelin Oligodendrocyte Glycoprotein 25 µg
RP17237160025 Myelin Oligodendrocyte Glycoprotein 25 mg
228-11133-1 Myelin Oligodendrocyte Glycoprotein 5 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur