Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

NACHT, LRR and PYD domains-containing protein 12 (Monarch-1) (PYRIN-containing APAF1-like protein 7) (Regulated by nitric oxide)

 NAL12_HUMAN             Reviewed;        1061 AA.
P59046; A8MTQ2; B3KTE7; Q8NEU4; Q9BY26;
19-OCT-2002, integrated into UniProtKB/Swiss-Prot.
22-AUG-2003, sequence version 2.
28-FEB-2018, entry version 154.
RecName: Full=NACHT, LRR and PYD domains-containing protein 12;
AltName: Full=Monarch-1;
AltName: Full=PYRIN-containing APAF1-like protein 7;
AltName: Full=Regulated by nitric oxide;
Name=NLRP12; Synonyms=NALP12, PYPAF7, RNO;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=12019269; DOI=10.1074/jbc.M203915200;
Wang L., Manji G.A., Grenier J.M., Al-Garawi A., Merriam S.,
Lora J.M., Geddes B.J., Briskin M., DiStefano P.S., Bertin J.;
"PYPAF7, a novel PYRIN-containing Apaf1-like protein that regulates
activation of NF-kappa B and caspase-1-dependent cytokine
processing.";
J. Biol. Chem. 277:29874-29880(2002).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=12563287; DOI=10.1038/nrm1019;
Tschopp J., Martinon F., Burns K.;
"NALPs: a novel protein family involved in inflammation.";
Nat. Rev. Mol. Cell Biol. 4:95-104(2003).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 7).
TISSUE=Lymphoma;
Williams K.L., Linhoff M.W., Harton J.A., Ting J.P.Y.;
Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), TISSUE SPECIFICITY,
ALTERNATIVE SPLICING, AND INDUCTION.
TISSUE=Peripheral blood leukocyte;
PubMed=11167794; DOI=10.1046/j.1365-2141.2001.02491.x;
Shami P.J., Kanai N., Wang L.Y., Vreeke T.M., Parker C.J.;
"Identification and characterization of a novel gene that is
upregulated in leukaemia cells by nitric oxide.";
Br. J. Haematol. 112:138-147(2001).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15057824; DOI=10.1038/nature02399;
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J.,
Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M.,
Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E.,
Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M.,
Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C.,
Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M.,
Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T.,
Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H.,
Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S.,
Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J.,
Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M.,
Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J.,
Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D.,
Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A.,
Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I.,
Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E.,
Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M.,
Rubin E.M., Lucas S.M.;
"The DNA sequence and biology of human chromosome 19.";
Nature 428:529-535(2004).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Leukocyte;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[9]
ATP-BINDING.
PubMed=18160710; DOI=10.1128/MCB.01468-07;
Ye Z., Lich J.D., Moore C.B., Duncan J.A., Williams K.L., Ting J.P.;
"ATP binding by monarch-1/NLRP12 is critical for its inhibitory
function.";
Mol. Cell. Biol. 28:1841-1850(2008).
[10]
INVOLVEMENT IN FCAS2.
PubMed=18230725; DOI=10.1073/pnas.0708616105;
Jeru I., Duquesnoy P., Fernandes-Alnemri T., Cochet E., Yu J.W.,
Lackmy-Port-Lis M., Grimprel E., Landman-Parker J., Hentgen V.,
Marlin S., McElreavey K., Sarkisian T., Grateau G., Alnemri E.S.,
Amselem S.;
"Mutations in NALP12 cause hereditary periodic fever syndromes.";
Proc. Natl. Acad. Sci. U.S.A. 105:1614-1619(2008).
[11]
STRUCTURE BY NMR OF 1-98, AND INTERACTION WITH FAF1.
PubMed=21978668; DOI=10.1016/j.jmb.2011.09.024;
Pinheiro A.S., Eibl C., Ekman-Vural Z., Schwarzenbacher R., Peti W.;
"The NLRP12 pyrin domain: structure, dynamics, and functional
insights.";
J. Mol. Biol. 413:790-803(2011).
-!- FUNCTION: May mediate activation of CASP1 via ASC and promote
activation of NF-kappa-B via IKK.
-!- SUBUNIT: Binds to ASC with its pyrin domain. Interacts with FAF1
UBA domain via its pyrin domain. {ECO:0000269|PubMed:21978668}.
-!- SUBCELLULAR LOCATION: Cytoplasm.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=7;
Name=1; Synonyms=I;
IsoId=P59046-1; Sequence=Displayed;
Name=2; Synonyms=II;
IsoId=P59046-2; Sequence=VSP_005524;
Name=3; Synonyms=III;
IsoId=P59046-3; Sequence=VSP_005523;
Name=4; Synonyms=IV;
IsoId=P59046-4; Sequence=VSP_009879;
Name=5; Synonyms=rno-2;
IsoId=P59046-5; Sequence=VSP_016908, VSP_016909, VSP_016910;
Name=6;
IsoId=P59046-6; Sequence=VSP_054622;
Note=No experimental confirmation available.;
Name=7;
IsoId=P59046-7; Sequence=VSP_055193;
Note=No experimental confirmation.;
-!- TISSUE SPECIFICITY: Detected only in peripheral blood leukocytes,
predominantly in eosinophils and granulocytes, and at lower levels
in monocytes. {ECO:0000269|PubMed:11167794}.
-!- INDUCTION: By nitric oxide and DMSO in HL-60 cells, an acute
myeloid leukemia cell line. {ECO:0000269|PubMed:11167794}.
-!- DISEASE: Familial cold autoinflammatory syndrome 2 (FCAS2)
[MIM:611762]: A rare autosomal dominant systemic inflammatory
disease characterized by recurrent episodes of maculopapular rash
associated with arthralgias, myalgias, fever and chills, swelling
of the extremities, and conjunctivitis after generalized exposure
to cold. {ECO:0000269|PubMed:18230725}. Note=The disease is caused
by mutations affecting the gene represented in this entry.
-!- SIMILARITY: Belongs to the NLRP family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AY095146; AAM18227.1; -; mRNA.
EMBL; AY154467; AAO18163.1; -; mRNA.
EMBL; AY116204; AAM75142.1; -; mRNA.
EMBL; AY116205; AAM75143.1; -; mRNA.
EMBL; AY116206; AAM75144.1; -; mRNA.
EMBL; AY116207; AAM75145.1; -; mRNA.
EMBL; AF231021; AAK14942.1; -; mRNA.
EMBL; AK095460; BAG53059.1; -; mRNA.
EMBL; AC008753; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471135; EAW72152.1; -; Genomic_DNA.
EMBL; BC028069; AAH28069.1; -; mRNA.
CCDS; CCDS12864.1; -. [P59046-1]
CCDS; CCDS62784.1; -. [P59046-6]
CCDS; CCDS62785.1; -. [P59046-7]
RefSeq; NP_001264055.1; NM_001277126.1. [P59046-7]
RefSeq; NP_001264058.1; NM_001277129.1. [P59046-6]
RefSeq; NP_653288.1; NM_144687.3. [P59046-1]
UniGene; Hs.631573; -.
PDB; 2L6A; NMR; -; A=1-98.
PDB; 4XHS; X-ray; 1.70 A; A/B=10-106.
PDB; 5H7N; X-ray; 1.85 A; A/B=9-106.
PDBsum; 2L6A; -.
PDBsum; 4XHS; -.
PDBsum; 5H7N; -.
ProteinModelPortal; P59046; -.
SMR; P59046; -.
BioGrid; 124861; 5.
IntAct; P59046; 24.
MINT; P59046; -.
STRING; 9606.ENSP00000319377; -.
iPTMnet; P59046; -.
PhosphoSitePlus; P59046; -.
DMDM; 34223733; -.
PaxDb; P59046; -.
PeptideAtlas; P59046; -.
PRIDE; P59046; -.
DNASU; 91662; -.
Ensembl; ENST00000324134; ENSP00000319377; ENSG00000142405. [P59046-1]
Ensembl; ENST00000391773; ENSP00000375653; ENSG00000142405. [P59046-7]
Ensembl; ENST00000391775; ENSP00000375655; ENSG00000142405. [P59046-6]
GeneID; 91662; -.
KEGG; hsa:91662; -.
UCSC; uc002qch.6; human. [P59046-1]
CTD; 91662; -.
DisGeNET; 91662; -.
EuPathDB; HostDB:ENSG00000142405.21; -.
GeneCards; NLRP12; -.
HGNC; HGNC:22938; NLRP12.
HPA; HPA042981; -.
MalaCards; NLRP12; -.
MIM; 609648; gene.
MIM; 611762; phenotype.
neXtProt; NX_P59046; -.
OpenTargets; ENSG00000142405; -.
Orphanet; 247868; NLRP12-associated hereditary periodic fever syndrome.
PharmGKB; PA162397866; -.
eggNOG; ENOG410IE5X; Eukaryota.
eggNOG; ENOG4111H3D; LUCA.
GeneTree; ENSGT00900000140813; -.
HOGENOM; HOG000294064; -.
HOVERGEN; HBG063656; -.
InParanoid; P59046; -.
KO; K20865; -.
OMA; CLCWEEK; -.
OrthoDB; EOG091G01CG; -.
PhylomeDB; P59046; -.
TreeFam; TF340267; -.
EvolutionaryTrace; P59046; -.
GeneWiki; NLRP12; -.
GenomeRNAi; 91662; -.
PRO; PR:P59046; -.
Proteomes; UP000005640; Chromosome 19.
Bgee; ENSG00000142405; -.
CleanEx; HS_NLRP12; -.
ExpressionAtlas; P59046; baseline and differential.
Genevisible; P59046; HS.
GO; GO:0005737; C:cytoplasm; IDA:UniProtKB.
GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
GO; GO:0008656; F:cysteine-type endopeptidase activator activity involved in apoptotic process; NAS:UniProtKB.
GO; GO:0006919; P:activation of cysteine-type endopeptidase activity involved in apoptotic process; NAS:UniProtKB.
GO; GO:0071345; P:cellular response to cytokine stimulus; IEA:Ensembl.
GO; GO:0036336; P:dendritic cell migration; IEA:Ensembl.
GO; GO:0050710; P:negative regulation of cytokine secretion; IDA:HGNC.
GO; GO:0070373; P:negative regulation of ERK1 and ERK2 cascade; IEA:Ensembl.
GO; GO:0043124; P:negative regulation of I-kappaB kinase/NF-kappaB signaling; IDA:HGNC.
GO; GO:0050728; P:negative regulation of inflammatory response; IMP:BHF-UCL.
GO; GO:0050711; P:negative regulation of interleukin-1 secretion; IDA:HGNC.
GO; GO:0045409; P:negative regulation of interleukin-6 biosynthetic process; IDA:HGNC.
GO; GO:0032088; P:negative regulation of NF-kappaB transcription factor activity; IDA:BHF-UCL.
GO; GO:1901223; P:negative regulation of NIK/NF-kappaB signaling; IEA:Ensembl.
GO; GO:0031953; P:negative regulation of protein autophosphorylation; IDA:HGNC.
GO; GO:0009968; P:negative regulation of signal transduction; IDA:HGNC.
GO; GO:0045751; P:negative regulation of Toll signaling pathway; IDA:HGNC.
GO; GO:0050729; P:positive regulation of inflammatory response; NAS:UniProtKB.
GO; GO:0050718; P:positive regulation of interleukin-1 beta secretion; NAS:UniProtKB.
GO; GO:0045345; P:positive regulation of MHC class I biosynthetic process; IDA:MGI.
GO; GO:0043281; P:regulation of cysteine-type endopeptidase activity involved in apoptotic process; IDA:MGI.
GO; GO:0043122; P:regulation of I-kappaB kinase/NF-kappaB signaling; IDA:MGI.
GO; GO:0045381; P:regulation of interleukin-18 biosynthetic process; NAS:UniProtKB.
GO; GO:0008588; P:release of cytoplasmic sequestered NF-kappaB; IDA:UniProtKB.
GO; GO:0007165; P:signal transduction; NAS:UniProtKB.
Gene3D; 3.80.10.10; -; 1.
InterPro; IPR004020; DAPIN.
InterPro; IPR011029; DEATH-like_dom_sf.
InterPro; IPR001611; Leu-rich_rpt.
InterPro; IPR032675; LRR_dom_sf.
InterPro; IPR029495; NACHT-assoc.
InterPro; IPR007111; NACHT_NTPase.
InterPro; IPR027417; P-loop_NTPase.
Pfam; PF14484; FISNA; 1.
Pfam; PF13516; LRR_6; 5.
Pfam; PF02758; PYRIN; 1.
SMART; SM01288; FISNA; 1.
SMART; SM01289; PYRIN; 1.
SUPFAM; SSF47986; SSF47986; 1.
SUPFAM; SSF52540; SSF52540; 1.
PROSITE; PS50824; DAPIN; 1.
PROSITE; PS51450; LRR; 5.
PROSITE; PS50837; NACHT; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; ATP-binding; Complete proteome;
Cytoplasm; Leucine-rich repeat; Nucleotide-binding; Polymorphism;
Reference proteome; Repeat.
CHAIN 1 1061 NACHT, LRR and PYD domains-containing
protein 12.
/FTId=PRO_0000080899.
DOMAIN 1 95 Pyrin. {ECO:0000255|PROSITE-
ProRule:PRU00061}.
DOMAIN 211 528 NACHT. {ECO:0000255|PROSITE-
ProRule:PRU00136}.
REPEAT 828 848 LRR 1.
REPEAT 857 878 LRR 2.
REPEAT 885 906 LRR 3.
REPEAT 914 935 LRR 4.
REPEAT 942 962 LRR 5.
REPEAT 971 992 LRR 6.
REPEAT 999 1020 LRR 7.
REPEAT 1028 1049 LRR 8.
NP_BIND 217 224 ATP.
VAR_SEQ 1 717 Missing (in isoform 5).
{ECO:0000303|PubMed:11167794}.
/FTId=VSP_016908.
VAR_SEQ 691 691 L -> LR (in isoform 7).
{ECO:0000303|Ref.3}.
/FTId=VSP_055193.
VAR_SEQ 718 748 LSLYRNALGSRGVKLLCQGLRHPNCKLQNLR -> MSQAWW
HTSVSPATQEAKAGGLLQPRRQRLW (in isoform 5).
{ECO:0000303|PubMed:11167794}.
/FTId=VSP_016909.
VAR_SEQ 862 1031 Missing (in isoform 4).
{ECO:0000303|Ref.3}.
/FTId=VSP_009879.
VAR_SEQ 862 973 Missing (in isoform 3).
{ECO:0000303|Ref.3}.
/FTId=VSP_005523.
VAR_SEQ 920 976 Missing (in isoform 6).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_054622.
VAR_SEQ 921 977 Missing (in isoform 5).
{ECO:0000303|PubMed:11167794}.
/FTId=VSP_016910.
VAR_SEQ 976 1031 Missing (in isoform 2).
{ECO:0000303|Ref.3}.
/FTId=VSP_005524.
VARIANT 39 39 G -> V (in dbSNP:rs34436714).
/FTId=VAR_053620.
VARIANT 402 402 F -> L (in dbSNP:rs34971363).
/FTId=VAR_053621.
CONFLICT 648 648 M -> T (in Ref. 5; BAG53059).
{ECO:0000305}.
HELIX 10 17 {ECO:0000244|PDB:4XHS}.
HELIX 22 35 {ECO:0000244|PDB:4XHS}.
TURN 37 40 {ECO:0000244|PDB:2L6A}.
HELIX 45 48 {ECO:0000244|PDB:4XHS}.
HELIX 53 64 {ECO:0000244|PDB:4XHS}.
HELIX 66 77 {ECO:0000244|PDB:4XHS}.
TURN 78 81 {ECO:0000244|PDB:4XHS}.
HELIX 83 90 {ECO:0000244|PDB:4XHS}.
STRAND 95 98 {ECO:0000244|PDB:2L6A}.
SEQUENCE 1061 AA; 120173 MW; 8C10AFE4907C131B CRC64;
MLRTAGRDGL CRLSTYLEEL EAVELKKFKL YLGTATELGE GKIPWGSMEK AGPLEMAQLL
ITHFGPEEAW RLALSTFERI NRKDLWERGQ REDLVRDTPP GGPSSLGNQS TCLLEVSLVT
PRKDPQETYR DYVRRKFRLM EDRNARLGEC VNLSHRYTRL LLVKEHSNPM QVQQQLLDTG
RGHARTVGHQ ASPIKIETLF EPDEERPEPP RTVVMQGAAG IGKSMLAHKV MLDWADGKLF
QGRFDYLFYI NCREMNQSAT ECSMQDLIFS CWPEPSAPLQ ELIRVPERLL FIIDGFDELK
PSFHDPQGPW CLCWEEKRPT ELLLNSLIRK KLLPELSLLI TTRPTALEKL HRLLEHPRHV
EILGFSEAER KEYFYKYFHN AEQAGQVFNY VRDNEPLFTM CFVPLVCWVV CTCLQQQLEG
GGLLRQTSRT TTAVYMLYLL SLMQPKPGAP RLQPPPNQRG LCSLAADGLW NQKILFEEQD
LRKHGLDGED VSAFLNMNIF QKDINCERYY SFIHLSFQEF FAAMYYILDE GEGGAGPDQD
VTRLLTEYAF SERSFLALTS RFLFGLLNEE TRSHLEKSLC WKVSPHIKMD LLQWIQSKAQ
SDGSTLQQGS LEFFSCLYEI QEEEFIQQAL SHFQVIVVSN IASKMEHMVS SFCLKRCRSA
QVLHLYGATY SADGEDRARC SAGAHTLLVQ LPERTVLLDA YSEHLAAALC TNPNLIELSL
YRNALGSRGV KLLCQGLRHP NCKLQNLRLK RCRISSSACE DLSAALIANK NLTRMDLSGN
GVGFPGMMLL CEGLRHPQCR LQMIQLRKCQ LESGACQEMA SVLGTNPHLV ELDLTGNALE
DLGLRLLCQG LRHPVCRLRT LWLKICRLTA AACDELASTL SVNQSLRELD LSLNELGDLG
VLLLCEGLRH PTCKLQTLRL GICRLGSAAC EGLSVVLQAN HNLRELDLSF NDLGDWGLWL
LAEGLQHPAC RLQKLWLDSC GLTAKACENL YFTLGINQTL TDLYLTNNAL GDTGVRLLCK
RLSHPGCKLR VLWLFGMDLN KMTHSRLAAL RVTKPYLDIG C


Related products :

Catalog number Product name Quantity
EIAAB26310 Homo sapiens,Human,Monarch-1,NACHT, LRR and PYD domains-containing protein 12,NALP12,NLRP12,PYPAF7,PYRIN-containing APAF1-like protein 7,Regulated by nitric oxide,RNO
EIAAB26335 Cancer_testis antigen 58,CT58,Homo sapiens,Human,NACHT, LRR and PYD domains-containing protein 4,NALP4,NLRP4,PAAD and NACHT-containing protein 2,PAN2,PYPAF4,PYRIN and NACHT-containing protein 2,PYRIN-
EIAAB26340 Mouse,Mus musculus,NACHT, LRR and PYD domains-containing protein 6,Nalp6,Nlrp6,Pypaf5,PYRIN-containing APAF1-like protein 5-like
EIAAB26339 Homo sapiens,Human,NACHT, LRR and PYD domains-containing protein 6,NALP6,NLRP6,PYPAF5,PYRIN-containing APAF1-like protein 5
EIAAB26341 Angiotensin II_vasopressin receptor,Avr,NACHT, LRR and PYD domains-containing protein 6,Nalp6,Nlrp6,Pypaf5,PYRIN-containing APAF1-like protein 5-like,Rat,Rattus norvegicus
EIAAB26342 Homo sapiens,Human,NACHT, LRR and PYD domains-containing protein 7,NALP7,NLRP7,NOD12,Nucleotide-binding oligomerization domain protein 12,PYPAF3,PYRIN-containing APAF1-like protein 3
EIAAB26331 Homo sapiens,Human,NACHT, LRR and PYD domains-containing protein 2,NALP2,NBS1,NLRP2,Nucleotide-binding site protein 1,PAN1,PYPAF2,PYRIN domain and NACHT domain-containing protein 1,PYRIN-containing AP
EIAAB26344 Homo sapiens,Human,NACHT, LRR and PYD domains-containing protein 9,NALP9,NLRP9,NOD6,Nucleotide-binding oligomerization domain protein 6,PAN12,PYRIN and NACHT-containing protein 12
EIAAB26343 Homo sapiens,Human,NACHT, LRR and PYD domains-containing protein 8,NALP8,NLRP8,NOD16,Nucleotide-binding oligomerization domain protein 16,PAN4,PYRIN and NACHT-containing protein 4
EIAAB26309 Homo sapiens,Human,NACHT, LRR and PYD domains-containing protein 11,NALP11,NLRP11,NOD17,Nucleotide-binding oligomerization domain protein 17,PAAD-and NACHT domain-containing protein 10,PAN10,PYPAF6,PY
EIAAB05292 Capon,Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein,C-terminal PDZ ligand of neuronal nitric oxide synthase protein,Nitric oxide synthase 1 adaptor protein,Nos1ap,Rat,Rattus n
EIAAB05293 CAPON,Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein,C-terminal PDZ ligand of neuronal nitric oxide synthase protein,Homo sapiens,Human,KIAA0464,Nitric oxide synthase 1 adaptor
EIAAB05291 Capon,Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein,C-terminal PDZ ligand of neuronal nitric oxide synthase protein,Kiaa0464,Mouse,Mus musculus,Nitric oxide synthase 1 adaptor
EIAAB26330 CARD7,Caspase recruitment domain-containing protein 7,Death effector filament-forming ced-4-like apoptosis protein,DEFCAP,Homo sapiens,Human,KIAA0926,NAC,NACHT, LRR and PYD domains-containing protein
EIAAB26332 Cias1,Cold autoinflammatory syndrome 1 protein homolog,Cryopyrin,Mast cell maturation-associated-inducible protein 1,Mmig1,Mouse,Mus musculus,NACHT, LRR and PYD domains-containing protein 3,Nalp3,Nlrp
EIAAB26313 Homo sapiens,Human,NACHT, LRR and PYD domains-containing protein 14,NALP14,NLRP14,NOD5,Nucleotide-binding oligomerization domain protein 5
EIAAB26311 Homo sapiens,Human,NACHT, LRR and PYD domains-containing protein 13,NALP13,NLRP13,NOD14,Nucleotide-binding oligomerization domain protein 14
EIAAB26336 Mater,Mater protein,Maternal antigen that embryos require,Mouse,Mus musculus,NACHT, LRR and PYD domains-containing protein 5,Nalp5,Nlrp5,Ooplasm-specific protein 1,OP1
EIAAB26307 Homo sapiens,Human,NACHT, LRR and PYD domains-containing protein 10,NALP10,NLRP10,NOD8,Nucleotide-binding oligomerization domain protein 8,PYNOD
E0179m Mouse ELISA Kit FOR NACHT, LRR and PYD domains-containing protein 4A 96T
NAL4F_MOUSE Mouse ELISA Kit FOR NACHT, LRR and PYD domains-containing protein 4F 96T
GLYG_HUMAN Mouse ELISA Kit FOR NACHT, LRR and PYD domains-containing protein 4A 96T
E0670d Human ELISA Kit FOR NACHT, LRR and PYD domains-containing protein 9 96T
TNR6A_HUMAN Mouse ELISA Kit FOR NACHT, LRR and PYD domains-containing protein 4A 96T
DX39A_HUMAN Human ELISA Kit FOR NACHT, LRR and PYD domains-containing protein 5 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur