Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Nebulette (Actin-binding Z-disk protein)

 NEBL_HUMAN              Reviewed;        1014 AA.
O76041; B0YJ45; Q2TBD0; Q70I54; Q9UIC4;
21-FEB-2001, integrated into UniProtKB/Swiss-Prot.
01-NOV-1998, sequence version 1.
10-OCT-2018, entry version 159.
RecName: Full=Nebulette;
AltName: Full=Actin-binding Z-disk protein;
Name=NEBL; Synonyms=LNEBL;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Heart muscle;
PubMed=9733644; DOI=10.1006/jmbi.1998.1999;
Millevoi S., Trombitas K., Kolmerer B., Kostin S., Schaper J.,
Pelin K., Granzier H., Labeit S.;
"Characterization of nebulette and nebulin and emerging concepts of
their roles for vertebrate Z-discs.";
J. Mol. Biol. 282:111-123(1998).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Heart;
PubMed=10470015;
DOI=10.1002/(SICI)1097-0169(199909)44:1<1::AID-CM1>3.0.CO;2-8;
Moncman C.L., Wang K.;
"Functional dissection of nebulette demonstrates actin binding of
nebulin-like repeats and Z-line targeting of SH3 and linker domains.";
Cell Motil. Cytoskeleton 44:1-22(1999).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH
ZYX, AND SUBCELLULAR LOCATION (ISOFORM 2).
TISSUE=Placenta;
PubMed=15004028; DOI=10.1074/jbc.M310304200;
Li B., Zhuang L., Trueb B.;
"Zyxin interacts with the SH3 domains of the cytoskeletal proteins
LIM-nebulette and Lasp-1.";
J. Biol. Chem. 279:20401-20410(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Brain;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
NHLBI resequencing and genotyping service (RS&G);
Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15164054; DOI=10.1038/nature02462;
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L.,
Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K.,
Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L.,
Taylor A., Battles J., Bird C.P., Ainscough R., Almeida J.P.,
Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J.,
Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J.,
Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D.,
Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S.,
Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L.,
Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S.,
Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L.,
Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J.,
Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M.,
Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S.,
Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M.,
Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A.,
Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T.,
Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I.,
Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T.,
Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M.,
Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W.,
Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H.,
Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L.,
Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K.,
Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T.,
Doucette-Stamm L., Beck S., Smith D.R., Rogers J.;
"The DNA sequence and comparative analysis of human chromosome 10.";
Nature 429:375-381(2004).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[9]
METHYLATION [LARGE SCALE ANALYSIS] AT ARG-795, METHYLATION [LARGE
SCALE ANALYSIS] AT ARG-96 (ISOFORM 2), AND IDENTIFICATION BY MASS
SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Colon carcinoma;
PubMed=24129315; DOI=10.1074/mcp.O113.027870;
Guo A., Gu H., Zhou J., Mulhern D., Wang Y., Lee K.A., Yang V.,
Aguiar M., Kornhauser J., Jia X., Ren J., Beausoleil S.A., Silva J.C.,
Vemulapalli V., Bedford M.T., Comb M.J.;
"Immunoaffinity enrichment and mass spectrometry analysis of protein
methylation.";
Mol. Cell. Proteomics 13:372-387(2014).
[10]
FUNCTION, AND INTERACTION WITH DES.
PubMed=27733623; DOI=10.1091/mbc.E16-04-0237;
Hernandez D.A., Bennett C.M., Dunina-Barkovskaya L., Wedig T.,
Capetanaki Y., Herrmann H., Conover G.M.;
"Nebulette is a powerful cytolinker organizing desmin and actin in
mouse hearts.";
Mol. Biol. Cell 27:3869-3882(2016).
[11]
VARIANTS HIS-187; VAL-351; LYS-654 AND ALA-728.
PubMed=11140941; DOI=10.1007/s004390000389;
Arimura T., Nakamura T., Hiroi S., Satoh M., Takahashi M., Ohbuchi N.,
Ueda K., Nouchi T., Yamaguchi N., Akai J., Matsumori A., Sasayama S.,
Kimura A.;
"Characterization of the human nebulette gene: a polymorphism in an
actin-binding motif is associated with nonfamilial idiopathic dilated
cardiomyopathy.";
Hum. Genet. 107:440-451(2000).
-!- FUNCTION: Binds to actin and plays an important role in the
assembly of the Z-disk. May functionally link sarcomeric actin to
the desmin intermediate filaments in the heart muscle sarcomeres
(PubMed:27733623). Isoform 2 might play a role in the assembly of
focal adhesion (PubMed:15004028). {ECO:0000269|PubMed:15004028,
ECO:0000269|PubMed:27733623}.
-!- SUBUNIT: Isoform 2 interacts with ZYX (Zyxin) (PubMed:15004028).
Interacts (via nebulin repeats 1-5) with DESM (via rod region)
(PubMed:27733623). {ECO:0000269|PubMed:15004028,
ECO:0000269|PubMed:27733623}.
-!- INTERACTION:
B2R8Y4:-; NbExp=3; IntAct=EBI-2880203, EBI-10175581;
Q8IZU0:FAM9B; NbExp=3; IntAct=EBI-2880203, EBI-10175124;
Q53SE7:FLJ13057; NbExp=3; IntAct=EBI-2880203, EBI-10172181;
Q08379:GOLGA2; NbExp=3; IntAct=EBI-2880203, EBI-618309;
Q9NSC5:HOMER3; NbExp=3; IntAct=EBI-2880203, EBI-748420;
Q9BRK4:LZTS2; NbExp=3; IntAct=EBI-2880203, EBI-741037;
Q9Y6D9:MAD1L1; NbExp=5; IntAct=EBI-2880203, EBI-742610;
Q8TD10:MIPOL1; NbExp=3; IntAct=EBI-2880203, EBI-2548751;
Q86Y26:NUTM1; NbExp=3; IntAct=EBI-2880203, EBI-10178410;
Q13077:TRAF1; NbExp=3; IntAct=EBI-2880203, EBI-359224;
Q12933:TRAF2; NbExp=5; IntAct=EBI-2880203, EBI-355744;
P14373:TRIM27; NbExp=3; IntAct=EBI-2880203, EBI-719493;
Q8N5A5-2:ZGPAT; NbExp=3; IntAct=EBI-2880203, EBI-10183064;
-!- SUBCELLULAR LOCATION: Isoform 2: Cytoplasm
{ECO:0000269|PubMed:15004028}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=O76041-1; Sequence=Displayed;
Name=2; Synonyms=LIM-nebulette, LNEBL;
IsoId=O76041-2; Sequence=VSP_043816, VSP_043817, VSP_043818;
Note=Expressed in non-muscle cells. May be transcribed from an
upstream promoter active in non-muscle cells. Contains a
omega-N-methylarginine at position 96.
{ECO:0000244|PubMed:24129315};
-!- TISSUE SPECIFICITY: Abundantly expressed in cardiac muscle, but
not in skeletal or smooth muscle. Localized to Z-lines in cardiac
cells and to dense bodies in nonmuscle cells. Isoform 2 is
expressed in non-muscle cells such as in fibroblasts.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; Y16241; CAA76130.1; -; mRNA.
EMBL; Y17673; CAA76810.1; -; mRNA.
EMBL; AF047368; AAF24858.1; -; mRNA.
EMBL; AJ580772; CAE45323.1; -; mRNA.
EMBL; AK295186; BAG58190.1; -; mRNA.
EMBL; EF445000; ACA06022.1; -; Genomic_DNA.
EMBL; EF445000; ACA06023.1; -; Genomic_DNA.
EMBL; EF445000; ACA06024.1; -; Genomic_DNA.
EMBL; EF445000; ACA06026.1; -; Genomic_DNA.
EMBL; AL359175; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL731547; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL157398; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL158160; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471072; EAW86175.1; -; Genomic_DNA.
EMBL; BC110453; AAI10454.1; -; mRNA.
EMBL; BC126132; AAI26133.1; -; mRNA.
EMBL; BC126134; AAI26135.1; -; mRNA.
CCDS; CCDS7133.1; -. [O76041-2]
CCDS; CCDS7134.1; -. [O76041-1]
RefSeq; NP_001166955.1; NM_001173484.1.
RefSeq; NP_006384.1; NM_006393.2. [O76041-1]
RefSeq; NP_998734.1; NM_213569.2. [O76041-2]
UniGene; Hs.5025; -.
PDB; 4F14; X-ray; 1.20 A; A=955-1014.
PDBsum; 4F14; -.
ProteinModelPortal; O76041; -.
SMR; O76041; -.
BioGrid; 115784; 32.
IntAct; O76041; 34.
MINT; O76041; -.
STRING; 9606.ENSP00000366326; -.
iPTMnet; O76041; -.
PhosphoSitePlus; O76041; -.
SwissPalm; O76041; -.
BioMuta; NEBL; -.
EPD; O76041; -.
PaxDb; O76041; -.
PeptideAtlas; O76041; -.
PRIDE; O76041; -.
ProteomicsDB; 50360; -.
ProteomicsDB; 50361; -. [O76041-2]
Ensembl; ENST00000377122; ENSP00000366326; ENSG00000078114. [O76041-1]
Ensembl; ENST00000417816; ENSP00000393896; ENSG00000078114. [O76041-2]
GeneID; 10529; -.
KEGG; hsa:10529; -.
UCSC; uc001iqi.4; human. [O76041-1]
CTD; 10529; -.
DisGeNET; 10529; -.
EuPathDB; HostDB:ENSG00000078114.18; -.
GeneCards; NEBL; -.
HGNC; HGNC:16932; NEBL.
HPA; HPA013994; -.
HPA; HPA013995; -.
MalaCards; NEBL; -.
MIM; 605491; gene.
neXtProt; NX_O76041; -.
OpenTargets; ENSG00000078114; -.
PharmGKB; PA134981177; -.
eggNOG; ENOG410IP6T; Eukaryota.
eggNOG; ENOG410Y1M0; LUCA.
GeneTree; ENSGT00530000062924; -.
HOGENOM; HOG000048710; -.
HOVERGEN; HBG054636; -.
InParanoid; O76041; -.
OMA; CTPIDEG; -.
OrthoDB; EOG091G0U2O; -.
PhylomeDB; O76041; -.
TreeFam; TF319104; -.
ChiTaRS; NEBL; human.
GenomeRNAi; 10529; -.
PRO; PR:O76041; -.
Proteomes; UP000005640; Chromosome 10.
Bgee; ENSG00000078114; Expressed in 214 organ(s), highest expression level in myocardium.
CleanEx; HS_NEBL; -.
ExpressionAtlas; O76041; baseline and differential.
Genevisible; O76041; HS.
GO; GO:0070062; C:extracellular exosome; HDA:UniProtKB.
GO; GO:0031674; C:I band; NAS:UniProtKB.
GO; GO:0001725; C:stress fiber; IDA:UniProtKB.
GO; GO:0030018; C:Z disc; IDA:UniProtKB.
GO; GO:0051015; F:actin filament binding; IDA:UniProtKB.
GO; GO:0008092; F:cytoskeletal protein binding; IDA:UniProtKB.
GO; GO:0031005; F:filamin binding; IPI:UniProtKB.
GO; GO:0008307; F:structural constituent of muscle; NAS:UniProtKB.
GO; GO:0005523; F:tropomyosin binding; IPI:UniProtKB.
GO; GO:0071691; P:cardiac muscle thin filament assembly; IMP:UniProtKB.
CDD; cd11935; SH3_Nebulette_C; 1.
InterPro; IPR035631; Nebulette_SH3.
InterPro; IPR000900; Nebulin_repeat.
InterPro; IPR036028; SH3-like_dom_sf.
InterPro; IPR001452; SH3_domain.
Pfam; PF00880; Nebulin; 15.
Pfam; PF14604; SH3_9; 1.
PRINTS; PR00452; SH3DOMAIN.
SMART; SM00227; NEBU; 23.
SMART; SM00326; SH3; 1.
SUPFAM; SSF50044; SSF50044; 1.
PROSITE; PS51216; NEBULIN; 23.
PROSITE; PS50002; SH3; 1.
1: Evidence at protein level;
3D-structure; Actin-binding; Alternative splicing; Complete proteome;
Cytoplasm; Methylation; Polymorphism; Reference proteome; Repeat;
SH3 domain.
CHAIN 1 1014 Nebulette.
/FTId=PRO_0000096774.
REPEAT 29 63 Nebulin 1.
REPEAT 64 99 Nebulin 2.
REPEAT 100 136 Nebulin 3.
REPEAT 137 172 Nebulin 4.
REPEAT 173 205 Nebulin 5.
REPEAT 206 241 Nebulin 6.
REPEAT 242 278 Nebulin 7.
REPEAT 279 313 Nebulin 8.
REPEAT 314 348 Nebulin 9.
REPEAT 349 385 Nebulin 10.
REPEAT 386 422 Nebulin 11.
REPEAT 423 459 Nebulin 12.
REPEAT 460 496 Nebulin 13.
REPEAT 497 533 Nebulin 14.
REPEAT 534 569 Nebulin 15.
REPEAT 570 599 Nebulin 16.
REPEAT 600 635 Nebulin 17.
REPEAT 636 666 Nebulin 18.
REPEAT 667 693 Nebulin 19.
REPEAT 694 728 Nebulin 20.
REPEAT 729 759 Nebulin 21.
REPEAT 760 794 Nebulin 22.
REPEAT 795 830 Nebulin 23.
DOMAIN 954 1014 SH3. {ECO:0000255|PROSITE-
ProRule:PRU00192}.
REGION 836 953 Linker.
MOD_RES 795 795 Omega-N-methylarginine.
{ECO:0000244|PubMed:24129315}.
VAR_SEQ 1 664 Missing (in isoform 2).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15004028,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_043816.
VAR_SEQ 665 782 TPVSMTPEIERVRRNQEQLSAVKYKGELQRGTAISDPPELK
RAKENQKNISNVYYRGQLGRATTLSVTPEMERVKKNQENIS
SVKYTQDHKQMKGRPSLILDTPAMRHVKEAQNHISM -> M
NPQCARCGKVVYPTEKVNCLDKYWHKGCFHCEVCKMALNMN
NYKGYEKKPYCNAHYPKQSFTTVADTPENLRLKQQSELQSQ
VKYKRDFEESKGRGFSIVTDTPELQRLKRTQEQISN (in
isoform 2). {ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15004028,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_043817.
VAR_SEQ 840 920 Missing (in isoform 2).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15004028,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_043818.
VARIANT 187 187 Q -> H (in dbSNP:rs75301590).
{ECO:0000269|PubMed:11140941}.
/FTId=VAR_010289.
VARIANT 219 219 A -> D (in dbSNP:rs2296610).
/FTId=VAR_021887.
VARIANT 351 351 M -> V (in dbSNP:rs4025981).
{ECO:0000269|PubMed:11140941}.
/FTId=VAR_010290.
VARIANT 378 378 D -> H (in dbSNP:rs41277370).
/FTId=VAR_051229.
VARIANT 654 654 N -> K (higher frequency of homozygotes
in a cohort of non-familial
cardiomyopathy Japanese patients as
compared to healthy controls;
dbSNP:rs4748728).
{ECO:0000269|PubMed:11140941}.
/FTId=VAR_010291.
VARIANT 728 728 T -> A (in dbSNP:rs71535732).
{ECO:0000269|PubMed:11140941}.
/FTId=VAR_010292.
CONFLICT 53 60 RYKEEFKK -> VIKKSLKS (in Ref. 2;
AAF24858). {ECO:0000305}.
CONFLICT 75 75 N -> T (in Ref. 2; AAF24858).
{ECO:0000305}.
CONFLICT 129 138 KHDAAKGFSD -> NMMLPRILS (in Ref. 2;
AAF24858). {ECO:0000305}.
CONFLICT 439 445 RASEMAS -> QPLKWQG (in Ref. 2; AAF24858).
{ECO:0000305}.
CONFLICT 706 726 RAKENQKNISNVYYRGQLGRA -> PKETRKTSACLLQSSA
GES (in Ref. 2; AAF24858). {ECO:0000305}.
CONFLICT 732 732 T -> I (in Ref. 2; AAF24858).
{ECO:0000305}.
CONFLICT 740 740 K -> E (in Ref. 2; AAF24858).
{ECO:0000305}.
CONFLICT 743 743 E -> G (in Ref. 2; AAF24858).
{ECO:0000305}.
CONFLICT 902 904 EIY -> RDL (in Ref. 2; AAF24858).
{ECO:0000305}.
STRAND 959 963 {ECO:0000244|PDB:4F14}.
STRAND 980 986 {ECO:0000244|PDB:4F14}.
STRAND 988 996 {ECO:0000244|PDB:4F14}.
TURN 997 1000 {ECO:0000244|PDB:4F14}.
STRAND 1001 1006 {ECO:0000244|PDB:4F14}.
HELIX 1007 1009 {ECO:0000244|PDB:4F14}.
STRAND 1010 1012 {ECO:0000244|PDB:4F14}.
SEQUENCE 1014 AA; 116453 MW; 81712E38BC6AC9E1 CRC64;
MRVPVFEDIK DETEEEKIGE EENEEDQVFY KPVIEDLSME LARKCTELIS DIRYKEEFKK
SKDKCTFVTD SPMLNHVKNI GAFISEAKYK GTIKADLSNS LYKRMPATID SVFAGEVTQL
QSEVAYKQKH DAAKGFSDYA HMKEPPEVKH AMEVNKHQSN ISYRKDVQDT HTYSAELDRP
DIKMATQISK IISNAEYKKG QGIMNKEPAV IGRPDFEHAV EASKLSSQIK YKEKFDNEMK
DKKHHYNPLE SASFRQNQLA ATLASNVKYK KDIQNMHDPV SDLPNLLFLD HVLKASKMLS
GREYKKLFEE NKGMYHFDAD AVEHLHHKGN AVLQSQVKYK EEYEKNKGKP MLEFVETPSY
QASKEAQKMQ SEKVYKEDFE KEIKGRSSLD LDKTPEFLHV KYITNLLREK EYKKDLENEI
KGKGMELNSE VLDIQRAKRA SEMASEKEYK KDLESIIKGK GMQAGTDTLE MQHAKKAAEI
ASEKDYKRDL ETEIKGKGMQ VSTDTLDVQR AKKASEMASQ KQYKKDLENE IKGKGMQVSM
DIPDILRAKR TSEIYSQRKY KDEAEKMLSN YSTIADTPEI QRIKTTQQNI SAVFYKKEVG
AGTAVKDSPE IERVKKNQQN ISSVKYKEEI KHATAISDPP ELKRVKENQK NISNLQYKEQ
NYKATPVSMT PEIERVRRNQ EQLSAVKYKG ELQRGTAISD PPELKRAKEN QKNISNVYYR
GQLGRATTLS VTPEMERVKK NQENISSVKY TQDHKQMKGR PSLILDTPAM RHVKEAQNHI
SMVKYHEDFE KTKGRGFTPV VDDPVTERVR KNTQVVSDAA YKGVHPHIVE MDRRPGIIVD
LKVWRTDPGS IFDLDPLEDN IQSRSLHMLS EKASHYRRHW SRSHSSSTFG TGLGDDRSEI
SEIYPSFSCC SEVTRPSDEG APVLPGAYQQ SHSQGYGYMH QTSVSSMRSM QHSPNLRTYR
AMYDYSAQDE DEVSFRDGDY IVNVQPIDDG WMYGTVQRTG RTGMLPANYI EFVN


Related products :

Catalog number Product name Quantity
EIAAB26829 Actin-binding Z-disk protein,Homo sapiens,Human,NEBL,Nebulette
30-394 DSTN belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. It is the actin depolymerizing protein that severs actin 0.05 mg
EIAAB46506 Beta-xin,Cardiomyopathy-associated protein 3,Cmya3,L-NAME-induced actin cytoskeletal protein,Rat,Rattus norvegicus,Xin actin-binding repeat-containing protein 2,Xin2,Xirp2
30-801 WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal 0.05 mg
30-802 WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal 0.05 mg
LCE2C_HUMAN Mouse ELISA Kit FOR LIM zinc-binding domain-containing Nebulette 96T
E0241m Mouse ELISA Kit FOR LIM zinc-binding domain-containing Nebulette 96T
AEN_MOUSE Mouse ELISA Kit FOR LIM zinc-binding domain-containing Nebulette 96T
30-387 PFN1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is assoc 0.05 mg
EIAAB41386 Homo sapiens,HRIHFB2122,Human,KIAA1662,Protein Tara,TARA,TRIO and F-actin-binding protein,Trio-associated repeat on actin,TRIOBP
EIAAB33191 Mouse,Mus musculus,Purb,Purine-rich element-binding protein B,Transcriptional activator protein Pur-beta,Vascular actin single-stranded DNA-binding factor 2 p44 component
EIAAB41387 Kiaa1662,Mouse,Mus musculus,Protein Tara,Tara,TRIO and F-actin-binding protein,Trio-associated repeat on actin,Triobp
orb84841 Beta actin protein Beta actin protein recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 383 amino acids and having a molecular mass of 42.8 kDa. The beta actin protein i 0.5 mg
EIAAB34105 Homo sapiens,Human,KIAA1470,Protein RCC2,RCC1-like protein TD-60,RCC2,TD60,Telophase disk protein of 60 kDa
EIAAB10484 Abp1,Actin-binding protein 1,Dbnl,Drebrin-like protein,Mouse,Mus musculus,SH3 domain-containing protein 7,Sh3p7
EIAAB10486 Abp1,Actin-binding protein 1,Dbnl,Drebrin-like protein,Rat,Rattus norvegicus,SH3 domain-containing protein 7,Sh3p7
27-211 This protein is an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinoge 0.05 mg
EIAAB46502 Cardiomyopathy-associated protein 1,Cmya1,Mouse,Mus musculus,Xin,Xin actin-binding repeat-containing protein 1,Xirp1
EIAAB46503 Cardiomyopathy-associated protein 1,CMYA1,Homo sapiens,Human,XIN,Xin actin-binding repeat-containing protein 1,XIRP1
EIAAB46505 Beta-xin,Cardiomyopathy-associated protein 3,Cmya3,Mouse,Mus musculus,mXinbeta,Myogenic MEF2-activated Xin-related protein,Myomaxin,Xin actin-binding repeat-containing protein 2,Xin2,Xirp2
LIMA1_PIG Pig ELISA Kit FOR LIM domain and actin-binding protein 1 96T
ABLIM3 ABLIM1 Gene actin binding LIM protein 1
E0814h Mouse ELISA Kit FOR Actin-binding protein IPP 96T
ARP58488_P050 KPTN(kaptin (actin binding protein)) 50 µg
CSB-EL001108RA Rat Actin-binding LIM protein 2(ABLIM2) ELISA kit 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur