Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Neuropeptide S receptor (G-protein coupled receptor 154) (G-protein coupled receptor PGR14) (G-protein coupled receptor for asthma susceptibility)

 NPSR1_HUMAN             Reviewed;         371 AA.
Q6W5P4; A2RTZ4; Q2XP58; Q56H76; Q56H77; Q56H78; Q6JSL4; Q6JSL5;
Q6JSL6; Q6JSL7; Q6JSL8; Q6W5P3; Q6ZMB8;
08-NOV-2005, integrated into UniProtKB/Swiss-Prot.
05-JUL-2004, sequence version 1.
20-DEC-2017, entry version 123.
RecName: Full=Neuropeptide S receptor;
AltName: Full=G-protein coupled receptor 154;
AltName: Full=G-protein coupled receptor PGR14;
AltName: Full=G-protein coupled receptor for asthma susceptibility;
Name=NPSR1; Synonyms=GPR154, GPRA, PGR14;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4), VARIANT ILE-107,
INVOLVEMENT IN ASRT2, AND TISSUE SPECIFICITY.
PubMed=15073379; DOI=10.1126/science.1090010;
Laitinen T., Polvi A., Rydman P., Vendelin J., Pulkkinen V.,
Salmikangas P., Maekelae S., Rehn M., Pirskanen A., Rautanen A.,
Zucchelli M., Gullsten H., Leino M., Alenius H., Petaeys T.,
Haahtela T., Laitinen A., Laprise C., Hudson T.J., Laitinen L.A.,
Kere J.;
"Characterization of a common susceptibility locus for asthma-related
traits.";
Science 304:300-304(2004).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 5; 6; 7 AND 9), FUNCTION,
SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
PubMed=15947423; DOI=10.1165/rcmb.2004-0405OC;
Vendelin J., Pulkkinen V., Rehn M., Pirskanen A.,
Raisanen-Sokolowski A., Laitinen A., Laitinen L.A., Kere J.,
Laitinen T.;
"Characterization of GPRA, a novel G protein-coupled receptor related
to asthma.";
Am. J. Respir. Cell Mol. Biol. 33:262-270(2005).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), AND VARIANT ILE-107.
Uebele V.N.;
"Human neuropeptide S receptor isoforms A and G: nucleotide and
deduced amino acid sequence.";
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8), AND VARIANT
ILE-107.
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS ILE-107; GLN-122;
GLY-143; PHE-197; ILE-212; ARG-241; THR-315 AND ARG-344.
SeattleSNPs variation discovery resource;
Submitted (OCT-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
FUNCTION.
PubMed=15312648; DOI=10.1016/j.neuron.2004.08.005;
Xu Y.-L., Reinscheid R.K., Huitron-Resendiz S., Clark S.D., Wang Z.,
Lin S.H., Brucher F.A., Zeng J., Ly N.K., Henriksen S.J., de Lecea L.,
Civelli O.;
"Neuropeptide S: a neuropeptide promoting arousal and anxiolytic-like
effects.";
Neuron 43:487-497(2004).
[9]
INVOLVEMENT IN ASRT2.
PubMed=15710598; DOI=10.1164/rccm.200410-1317OC;
Melen E., Bruce S., Doekes G., Kabesch M., Laitinen T., Lauener R.,
Lindgren C.M., Riedler J., Scheynius A., van Hage-Hamsten M., Kere J.,
Pershagen G., Wickman M., Nyberg F.;
"Haplotypes of G protein-coupled receptor 154 are associated with
childhood allergy and asthma.";
Am. J. Respir. Crit. Care Med. 171:1089-1095(2005).
[10]
INVOLVEMENT IN ASRT2.
PubMed=15764725; DOI=10.1164/rccm.200410-1312OC;
Kormann M.S., Carr D., Klopp N., Illig T., Leupold W., Fritzsch C.,
Weiland S.K., von Mutius E., Kabesch M.;
"G-protein-coupled receptor polymorphisms are associated with asthma
in a large German population.";
Am. J. Respir. Crit. Care Med. 171:1358-1362(2005).
[11]
CHARACTERIZATION OF VARIANT ILE-107, SUBCELLULAR LOCATION, AND
FUNCTION.
PubMed=16790440; DOI=10.1074/jbc.M603691200;
Bernier V., Stocco R., Bogusky M.J., Joyce J.G., Parachoniak C.,
Grenier K., Arget M., Mathieu M.C., O'Neill G.P., Slipetz D.,
Crackower M.A., Tan C.M., Therien A.G.;
"Structure-function relationships in the neuropeptide S receptor:
molecular consequences of the asthma-associated mutation N107I.";
J. Biol. Chem. 281:24704-24712(2006).
-!- FUNCTION: G-protein coupled receptor for neuropeptide S (NPS)
(PubMed:16790440). Promotes mobilization of intracellular Ca(2+)
stores (PubMed:16790440). Inhibits cell growth in response to NPS
binding (PubMed:15947423). Involved in pathogenesis of asthma and
other IgE-mediated diseases. {ECO:0000269|PubMed:15312648,
ECO:0000269|PubMed:15947423, ECO:0000269|PubMed:16790440}.
-!- SUBCELLULAR LOCATION: Isoform 1: Cell membrane
{ECO:0000269|PubMed:15947423, ECO:0000269|PubMed:16790440}; Multi-
pass membrane protein {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 3: Cell membrane
{ECO:0000269|PubMed:15947423}; Multi-pass membrane protein
{ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 4: Cell membrane
{ECO:0000269|PubMed:15947423}; Multi-pass membrane protein
{ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 2: Cytoplasm
{ECO:0000269|PubMed:15947423}.
-!- SUBCELLULAR LOCATION: Isoform 5: Cytoplasm
{ECO:0000269|PubMed:15947423}.
-!- SUBCELLULAR LOCATION: Isoform 6: Cytoplasm
{ECO:0000269|PubMed:15947423}.
-!- SUBCELLULAR LOCATION: Isoform 7: Cytoplasm
{ECO:0000269|PubMed:15947423}.
-!- SUBCELLULAR LOCATION: Isoform 9: Cytoplasm
{ECO:0000269|PubMed:15947423}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=9;
Name=1; Synonyms=Isoform A;
IsoId=Q6W5P4-1; Sequence=Displayed;
Name=2; Synonyms=Isoform F;
IsoId=Q6W5P4-2; Sequence=VSP_016079;
Name=3; Synonyms=Isoform G;
IsoId=Q6W5P4-3; Sequence=VSP_016088;
Name=4; Synonyms=Isoform B long form;
IsoId=Q6W5P4-4; Sequence=VSP_016089;
Name=5; Synonyms=Isoform B short form;
IsoId=Q6W5P4-5; Sequence=VSP_016078, VSP_016089;
Name=6; Synonyms=Isoform D;
IsoId=Q6W5P4-6; Sequence=VSP_016080, VSP_016087;
Name=7; Synonyms=Isoform E;
IsoId=Q6W5P4-7; Sequence=VSP_016083, VSP_016085;
Name=8;
IsoId=Q6W5P4-8; Sequence=VSP_016084, VSP_016086;
Note=No experimental confirmation available.;
Name=9; Synonyms=Isoform C;
IsoId=Q6W5P4-9; Sequence=VSP_016081, VSP_016082;
-!- TISSUE SPECIFICITY: Isoform 4 is ubiquitous; it is detected in
glandular epithelia of bronchus, stomach, small intestine, colon,
uterus, esophagus, spleen, kidney, pancreas, prostate and breast.
Isoform 1 is detected in uterus, colon and prostate, and in the
smooth muscle cell layer in bronchial and arterial walls (at
protein level) (PubMed:15947423). Isoform 1 is predominantly
expressed in smooth muscle. Isoform 4 is predominantly expressed
in epithelial cells. In bronchial biopsies, it is expressed in
smooth muscle cells of asthma patients, but not in control
patients; whereas in epithelial cells, its expression is
consistently stronger in asthma patients.
{ECO:0000269|PubMed:15073379, ECO:0000269|PubMed:15947423}.
-!- DISEASE: Asthma-related traits 2 (ASRT2) [MIM:608584]: Asthma-
related traits include clinical symptoms of asthma, such as
coughing, wheezing, dyspnea, bronchial hyperresponsiveness as
assessed by methacholine challenge test, serum IgE levels, atopy
and atopic dermatitis. {ECO:0000269|PubMed:15073379,
ECO:0000269|PubMed:15710598, ECO:0000269|PubMed:15764725}.
Note=Disease susceptibility is associated with variations
affecting the gene represented in this entry.
-!- MISCELLANEOUS: Only isoforms with 7 transmembrane topology
(isoform 1, isoform 3 and isoform 4) are transported into the
plasma membrane in transfected cells, while the truncated ones
retain intracellular compartments. {ECO:0000269|PubMed:15947423}.
-!- SIMILARITY: Belongs to the G-protein coupled receptor 1 family.
Vasopressin/oxytocin receptor subfamily. {ECO:0000255|PROSITE-
ProRule:PRU00521}.
-!- WEB RESOURCE: Name=SeattleSNPs;
URL="http://pga.gs.washington.edu/data/gpr154/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AY310326; AAQ76966.1; -; mRNA.
EMBL; AY310327; AAQ76967.1; -; mRNA.
EMBL; AY310328; AAQ76968.1; -; mRNA.
EMBL; AY310329; AAQ76969.1; -; mRNA.
EMBL; AY310330; AAQ76970.1; -; mRNA.
EMBL; AY310331; AAQ76971.1; -; mRNA.
EMBL; AY310332; AAQ76972.1; -; mRNA.
EMBL; AY956446; AAX63744.1; -; mRNA.
EMBL; AY956447; AAX63745.1; -; mRNA.
EMBL; AY956448; AAX63746.1; -; mRNA.
EMBL; AK172847; BAD18811.1; -; mRNA.
EMBL; DQ272236; ABB72550.1; -; Genomic_DNA.
EMBL; CH471073; EAW94036.1; -; Genomic_DNA.
EMBL; BC132693; AAI32694.1; -; mRNA.
EMBL; BC132695; AAI32696.1; -; mRNA.
CCDS; CCDS5443.1; -. [Q6W5P4-4]
CCDS; CCDS5444.1; -. [Q6W5P4-1]
CCDS; CCDS75579.1; -. [Q6W5P4-3]
CCDS; CCDS75580.1; -. [Q6W5P4-5]
CCDS; CCDS75581.1; -. [Q6W5P4-2]
RefSeq; NP_001287862.1; NM_001300933.1. [Q6W5P4-5]
RefSeq; NP_001287863.1; NM_001300934.1. [Q6W5P4-2]
RefSeq; NP_001287864.1; NM_001300935.1. [Q6W5P4-3]
RefSeq; NP_997055.1; NM_207172.1. [Q6W5P4-1]
RefSeq; NP_997056.1; NM_207173.1. [Q6W5P4-4]
UniGene; Hs.652373; -.
ProteinModelPortal; Q6W5P4; -.
STRING; 9606.ENSP00000352839; -.
BindingDB; Q6W5P4; -.
ChEMBL; CHEMBL5162; -.
DrugBank; DB01159; Halothane.
GuidetoPHARMACOLOGY; 302; -.
iPTMnet; Q6W5P4; -.
PhosphoSitePlus; Q6W5P4; -.
BioMuta; NPSR1; -.
DMDM; 74758626; -.
EPD; Q6W5P4; -.
PaxDb; Q6W5P4; -.
PeptideAtlas; Q6W5P4; -.
PRIDE; Q6W5P4; -.
DNASU; 387129; -.
Ensembl; ENST00000359791; ENSP00000352839; ENSG00000187258. [Q6W5P4-4]
Ensembl; ENST00000360581; ENSP00000353788; ENSG00000187258. [Q6W5P4-1]
Ensembl; ENST00000381539; ENSP00000370950; ENSG00000187258. [Q6W5P4-3]
Ensembl; ENST00000381542; ENSP00000370953; ENSG00000187258. [Q6W5P4-2]
Ensembl; ENST00000381544; ENSP00000370955; ENSG00000187258. [Q6W5P4-6]
Ensembl; ENST00000381553; ENSP00000370965; ENSG00000187258. [Q6W5P4-8]
Ensembl; ENST00000396095; ENSP00000379402; ENSG00000187258. [Q6W5P4-7]
Ensembl; ENST00000465305; ENSP00000434955; ENSG00000187258. [Q6W5P4-9]
Ensembl; ENST00000531252; ENSP00000433258; ENSG00000187258. [Q6W5P4-5]
GeneID; 387129; -.
KEGG; hsa:387129; -.
UCSC; uc003teg.1; human. [Q6W5P4-1]
CTD; 387129; -.
DisGeNET; 387129; -.
EuPathDB; HostDB:ENSG00000187258.13; -.
GeneCards; NPSR1; -.
HGNC; HGNC:23631; NPSR1.
HPA; HPA007489; -.
MalaCards; NPSR1; -.
MIM; 608584; phenotype.
MIM; 608595; gene.
neXtProt; NX_Q6W5P4; -.
OpenTargets; ENSG00000187258; -.
PharmGKB; PA134951416; -.
eggNOG; KOG3184; Eukaryota.
eggNOG; KOG3656; Eukaryota.
eggNOG; ENOG410XRW9; LUCA.
GeneTree; ENSGT00760000119156; -.
HOVERGEN; HBG106615; -.
InParanoid; Q6W5P4; -.
KO; K08376; -.
OMA; TIWMKSK; -.
OrthoDB; EOG091G0A5H; -.
PhylomeDB; Q6W5P4; -.
TreeFam; TF106499; -.
Reactome; R-HSA-375276; Peptide ligand-binding receptors.
Reactome; R-HSA-416476; G alpha (q) signalling events.
Reactome; R-HSA-418555; G alpha (s) signalling events.
GeneWiki; Neuropeptide_S_receptor; -.
GenomeRNAi; 387129; -.
PRO; PR:Q6W5P4; -.
Proteomes; UP000005640; Chromosome 7.
Bgee; ENSG00000187258; -.
ExpressionAtlas; Q6W5P4; baseline and differential.
GO; GO:0005737; C:cytoplasm; IDA:UniProtKB.
GO; GO:0005887; C:integral component of plasma membrane; IDA:UniProtKB.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0008188; F:neuropeptide receptor activity; IDA:UniProtKB.
GO; GO:0005000; F:vasopressin receptor activity; IEA:InterPro.
GO; GO:0007186; P:G-protein coupled receptor signaling pathway; TAS:Reactome.
GO; GO:0007218; P:neuropeptide signaling pathway; IDA:UniProtKB.
GO; GO:0051281; P:positive regulation of release of sequestered calcium ion into cytosol; IDA:UniProtKB.
InterPro; IPR000276; GPCR_Rhodpsn.
InterPro; IPR017452; GPCR_Rhodpsn_7TM.
InterPro; IPR027294; NPS_rcpt.
InterPro; IPR001817; Vasoprsn_rcpt.
PANTHER; PTHR24244:SF2; PTHR24244:SF2; 1.
Pfam; PF00001; 7tm_1; 1.
PRINTS; PR00237; GPCRRHODOPSN.
PRINTS; PR00896; VASOPRESSINR.
PROSITE; PS00237; G_PROTEIN_RECEP_F1_1; 1.
PROSITE; PS50262; G_PROTEIN_RECEP_F1_2; 1.
1: Evidence at protein level;
Alternative splicing; Asthma; Cell membrane; Complete proteome;
Cytoplasm; Disulfide bond; G-protein coupled receptor; Glycoprotein;
Membrane; Polymorphism; Receptor; Reference proteome; Transducer;
Transmembrane; Transmembrane helix.
CHAIN 1 371 Neuropeptide S receptor.
/FTId=PRO_0000069639.
TOPO_DOM 1 52 Extracellular. {ECO:0000255}.
TRANSMEM 53 73 Helical; Name=1. {ECO:0000255}.
TOPO_DOM 74 82 Cytoplasmic. {ECO:0000255}.
TRANSMEM 83 103 Helical; Name=2. {ECO:0000255}.
TOPO_DOM 104 123 Extracellular. {ECO:0000255}.
TRANSMEM 124 144 Helical; Name=3. {ECO:0000255}.
TOPO_DOM 145 164 Cytoplasmic. {ECO:0000255}.
TRANSMEM 165 185 Helical; Name=4. {ECO:0000255}.
TOPO_DOM 186 212 Extracellular. {ECO:0000255}.
TRANSMEM 213 233 Helical; Name=5. {ECO:0000255}.
TOPO_DOM 234 275 Cytoplasmic. {ECO:0000255}.
TRANSMEM 276 296 Helical; Name=6. {ECO:0000255}.
TOPO_DOM 297 312 Extracellular. {ECO:0000255}.
TRANSMEM 313 333 Helical; Name=7. {ECO:0000255}.
TOPO_DOM 334 371 Cytoplasmic. {ECO:0000255}.
CARBOHYD 4 4 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 121 197 {ECO:0000255|PROSITE-ProRule:PRU00521}.
VAR_SEQ 93 103 Missing (in isoform 5).
{ECO:0000303|PubMed:15947423}.
/FTId=VSP_016078.
VAR_SEQ 94 159 Missing (in isoform 2).
{ECO:0000303|PubMed:15947423}.
/FTId=VSP_016079.
VAR_SEQ 94 158 DSFTGLVNILTDINWRFTGDFTAPDLVCRVVRYLQVVLLYA
STYVLVSLSIDRYHAIVYPMKFLQ -> GCAALRLYLRPGV
PQHRQIPCHRLPHEVPSRRKASQGPHCDRLEPVFSVLHSHP
DHIWEEDTVQR (in isoform 6).
{ECO:0000303|PubMed:15947423}.
/FTId=VSP_016080.
VAR_SEQ 94 94 D -> V (in isoform 9).
{ECO:0000303|PubMed:15947423}.
/FTId=VSP_016081.
VAR_SEQ 95 371 Missing (in isoform 9).
{ECO:0000303|PubMed:15947423}.
/FTId=VSP_016082.
VAR_SEQ 129 136 VVLLYAST -> KSKPGSSL (in isoform 7).
{ECO:0000303|PubMed:15947423}.
/FTId=VSP_016083.
VAR_SEQ 130 143 VLLYASTYVLVSLS -> MVMKLFHIQKMNME (in
isoform 8).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_016084.
VAR_SEQ 137 371 Missing (in isoform 7).
{ECO:0000303|PubMed:15947423}.
/FTId=VSP_016085.
VAR_SEQ 144 371 Missing (in isoform 8).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_016086.
VAR_SEQ 159 371 Missing (in isoform 6).
{ECO:0000303|PubMed:15947423}.
/FTId=VSP_016087.
VAR_SEQ 343 371 EQRSQDSRMTFRERTERHEMQILSKPEFI -> ANSSVYLL
ACDVSVLWALVLTSEKESCESWRRKGAKITGFQNDVPGEN
(in isoform 3). {ECO:0000303|Ref.3}.
/FTId=VSP_016088.
VAR_SEQ 343 371 EQRSQDSRMTFRERTERHEMQILSKPEFI -> VIRLRQLQ
EAALMLCPQRENWKGTWPGVPSWALPR (in isoform 4
and isoform 5).
{ECO:0000303|PubMed:15073379,
ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:15947423}.
/FTId=VSP_016089.
VARIANT 107 107 N -> I (increases cell surface expression
and NPS-dependent calcium mobilization;
does not affect affinity for NPS.;
dbSNP:rs324981).
{ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:15073379,
ECO:0000269|PubMed:16790440,
ECO:0000269|Ref.3, ECO:0000269|Ref.5}.
/FTId=VAR_023757.
VARIANT 122 122 R -> Q (in dbSNP:rs35436513).
{ECO:0000269|Ref.5}.
/FTId=VAR_025103.
VARIANT 143 143 S -> G (in dbSNP:rs325465).
{ECO:0000269|Ref.5}.
/FTId=VAR_025104.
VARIANT 197 197 C -> F (in dbSNP:rs34705969).
{ECO:0000269|Ref.5}.
/FTId=VAR_025105.
VARIANT 212 212 T -> I (in dbSNP:rs35537374).
{ECO:0000269|Ref.5}.
/FTId=VAR_025106.
VARIANT 241 241 S -> R (in dbSNP:rs727162).
{ECO:0000269|Ref.5}.
/FTId=VAR_023758.
VARIANT 315 315 I -> T (in dbSNP:rs10270766).
{ECO:0000269|Ref.5}.
/FTId=VAR_025107.
VARIANT 344 344 Q -> R (in dbSNP:rs6972158).
{ECO:0000269|Ref.5}.
/FTId=VAR_023759.
SEQUENCE 371 AA; 42687 MW; EA084B381562353D CRC64;
MPANFTEGSF DSSGTGQTLD SSPVACTETV TFTEVVEGKE WGSFYYSFKT EQLITLWVLF
VFTIVGNSVV LFSTWRRKKK SRMTFFVTQL AITDSFTGLV NILTDINWRF TGDFTAPDLV
CRVVRYLQVV LLYASTYVLV SLSIDRYHAI VYPMKFLQGE KQARVLIVIA WSLSFLFSIP
TLIIFGKRTL SNGEVQCWAL WPDDSYWTPY MTIVAFLVYF IPLTIISIMY GIVIRTIWIK
SKTYETVISN CSDGKLCSSY NRGLISKAKI KAIKYSIIII LAFICCWSPY FLFDILDNFN
LLPDTQERFY ASVIIQNLPA LNSAINPLIY CVFSSSISFP CREQRSQDSR MTFRERTERH
EMQILSKPEF I


Related products :

Catalog number Product name Quantity
EIAAB27701 GPR154,GPRA,G-protein coupled receptor 154,G-protein coupled receptor for asthma susceptibility,G-protein coupled receptor PGR14,Homo sapiens,Human,Neuropeptide S receptor,NPSR1,PGR14
EIAAB27700 Gpr154,G-protein coupled receptor 154,G-protein coupled receptor PGR14,Mouse,Mus musculus,Neuropeptide S receptor,Npsr1,Pgr14
EIAAB27655 GPR74,G-protein coupled receptor 74,G-protein coupled receptor HLWAR77,Homo sapiens,Human,Neuropeptide FF receptor 2,Neuropeptide G-protein coupled receptor,NPFF2,NPFFR2,NPGPR
EIAAB28476 GPR120,GPR129,G-protein coupled receptor 120,G-protein coupled receptor 129,G-protein coupled receptor GT01,G-protein coupled receptor PGR4,Homo sapiens,Human,O3FAR1,Omega-3 fatty acid receptor 1,PGR4
EIAAB29406 5-oxo-ETE G-protein coupled receptor,GPR170,G-protein coupled receptor 170,G-protein coupled receptor R527,G-protein coupled receptor TG1019,Homo sapiens,Human,OXER1,Oxoeicosanoid receptor 1,TG1019
18-461-10342 Leucine-rich repeat-containing G-protein coupled receptor 5 - Orphan G-protein coupled receptor HG38; G-protein coupled receptor 49; G-protein coupled receptor 67 Polyclonal 0.05 ml
18-461-10341 Leucine-rich repeat-containing G-protein coupled receptor 5 - Orphan G-protein coupled receptor HG38; G-protein coupled receptor 49; G-protein coupled receptor 67 Polyclonal 0.05 ml
EIAAB36500 Gpr106,G-protein coupled receptor 106,G-protein coupled receptor affecting testicular descent,Great,Leucine-rich repeat-containing G-protein coupled receptor 8,Lgr8,Mouse,Mus musculus,Relaxin family p
EIAAB36499 GPR106,G-protein coupled receptor 106,G-protein coupled receptor affecting testicular descent,GREAT,Homo sapiens,Human,Leucine-rich repeat-containing G-protein coupled receptor 8,LGR8,Relaxin family p
EIAAB27654 Gpr74,G-protein coupled receptor 74,Neuropeptide FF receptor 2,Neuropeptide G-protein coupled receptor,Npff2,Npffr2,Npgpr,Rat,Rattus norvegicus
18-461-10719 Oxoeicosanoid receptor 1 - G-protein coupled receptor TG1019; 5-oxo-ETE G-protein coupled receptor; G-protein coupled receptor 170; G-protein coupled receptor R527 Polyclonal 0.05 ml
18-461-10430 Oxoeicosanoid receptor 1 - G-protein coupled receptor TG1019; 5-oxo-ETE G-protein coupled receptor; G-protein coupled receptor 170; G-protein coupled receptor R527 Polyclonal 0.05 ml
18-461-10045 Nicotinic acid receptor 2 - G-protein coupled receptor 109B; G-protein coupled receptor HM74; G-protein coupled receptor HM74B Polyclonal 0.05 ml
18-461-10046 Nicotinic acid receptor 2 - G-protein coupled receptor 109B; G-protein coupled receptor HM74; G-protein coupled receptor HM74B Polyclonal 0.05 ml
18-461-10047 Nicotinic acid receptor 2 - G-protein coupled receptor 109B; G-protein coupled receptor HM74; G-protein coupled receptor HM74B Polyclonal 0.05 ml
18-461-10042 Monogenic audiogenic seizure susceptibility protein 1 homolog - Very large G-protein coupled receptor 1; Usher syndrome type-2C protein; G-protein coupled receptor 98 Polyclonal 0.05 ml
18-461-10041 Monogenic audiogenic seizure susceptibility protein 1 homolog - Very large G-protein coupled receptor 1; Usher syndrome type-2C protein; G-protein coupled receptor 98 Polyclonal 0.05 ml
EIAAB45413 Bos taurus,Bovine,GPR14,G-protein coupled receptor 14,G-protein coupled sensory epithelial neuropeptide-like receptor,SENR,UR-2-R,UR-II-R,Urotensin II receptor,Urotensin-2 receptor,UTS2R
EIAAB28720 Bos taurus,Bovine,bRGR1,G protein-coupled receptor RGR1,GPR68,G-protein coupled receptor 68,Ovarian cancer G-protein coupled receptor 1
18-001-30048 Neuropeptide FF receptor 2 - Neuropeptide G-protein coupled receptor; G-protein coupled receptor 74; G-protein coupled receptor HLWAR77 Polyclonal 0.1 mg
18-461-10742 Neuropeptide FF receptor 2 - Neuropeptide G-protein coupled receptor; G-protein coupled receptor 74; G-protein coupled receptor HLWAR77 Polyclonal 0.05 ml
18-461-10306 Neuropeptide FF receptor 2 - Neuropeptide G-protein coupled receptor; G-protein coupled receptor 74; G-protein coupled receptor HLWAR77 Polyclonal 0.05 ml
18-461-10454 Neuropeptide FF receptor 2 - Neuropeptide G-protein coupled receptor; G-protein coupled receptor 74; G-protein coupled receptor HLWAR77 Polyclonal 0.05 ml
EIAAB36674 AGR16,Edg5,Endothelial differentiation G-protein coupled receptor 5,G-protein coupled receptor H218,Rat,Rattus norvegicus,S1P receptor 2,S1P receptor Edg-5,S1P2,S1pr2,Sphingosine 1-phosphate receptor
EIAAB25401 GPR140,GPR168,G-protein coupled receptor 140,G-protein coupled receptor 168,Homo sapiens,Human,Mas-related gene F protein,Mas-related G-protein coupled receptor member F,MRGF,MRGPRF,PSEC0142


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur