Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Noelin-3 (Olfactomedin-3) (Optimedin)

 NOE3_HUMAN              Reviewed;         478 AA.
Q96PB7; Q5T3V6; Q6IMI7; Q6IMI8; Q6IMI9; Q6IMJ1; Q8TBG1; Q96PB2;
Q96PB3; Q96PB4; Q96PB5; Q96PB6;
23-JAN-2002, integrated into UniProtKB/Swiss-Prot.
01-DEC-2001, sequence version 1.
23-MAY-2018, entry version 144.
RecName: Full=Noelin-3;
AltName: Full=Olfactomedin-3;
AltName: Full=Optimedin;
Flags: Precursor;
Name=OLFM3; Synonyms=NOE3; ORFNames=UNQ1924/PRO4399;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6).
Rhodes C.H., Call K.M., Little R., Braunschweiger K., Park J.P.;
"NOE3: a novel olfactomedin/noelin/pancortin homolog identified near
an ependymoma-associated translocation breakpoint.";
Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
TISSUE=Brain;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
TISSUE=Hippocampus;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
TISSUE SPECIFICITY.
PubMed=12019210; DOI=10.1093/hmg/11.11.1291;
Torrado M., Trivedi R., Zinovieva R., Karavanova I., Tomarev S.I.;
"Optimedin: a novel olfactomedin-related protein that interacts with
myocilin.";
Hum. Mol. Genet. 11:1291-1301(2002).
[8]
ALTERNATIVE SPLICING.
PubMed=15123989;
Mukhopadhyay A., Talukdar S., Bhattacharjee A., Ray K.;
"Bioinformatic approaches for identification and characterization of
olfactomedin related genes with a potential role in pathogenesis of
ocular disorders.";
Mol. Vis. 10:304-314(2004).
[9]
INTERACTION WITH OLFM2.
PubMed=21228389; DOI=10.1167/iovs.10-6356;
Sultana A., Nakaya N., Senatorov V.V., Tomarev S.I.;
"Olfactomedin 2: expression in the eye and interaction with other
olfactomedin domain-containing proteins.";
Invest. Ophthalmol. Vis. Sci. 52:2584-2592(2011).
-!- SUBUNIT: Peripherally associated with AMPAR complex. AMPAR complex
consists of an inner core made of 4 pore-forming GluA/GRIA
proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary
subunits arranged in a twofold symmetry. One of the two pairs of
distinct binding sites is occupied either by CNIH2, CNIH3 or
CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8
or GSG1L. This inner core of AMPAR complex is complemented by
outer core constituents binding directly to the GluA/GRIA proteins
at sites distinct from the interaction sites of the inner core
constituents. Outer core constituents include at least PRRT1,
PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner
and outer core serve as a platform for other, more peripherally
associated AMPAR constituents, including OLFM3. Alone or in
combination, these auxiliary subunits control the gating and
pharmacology of the AMPAR complex and profoundly impact their
biogenesis and protein processing. Homodimer. Interacts with MYOC
(By similarity). Interacts with OLFM2 (PubMed:21228389).
{ECO:0000250, ECO:0000269|PubMed:21228389}.
-!- INTERACTION:
Q6UY14-3:ADAMTSL4; NbExp=3; IntAct=EBI-10292253, EBI-10173507;
O76003:GLRX3; NbExp=3; IntAct=EBI-10292253, EBI-374781;
Q9UNE7:STUB1; NbExp=3; IntAct=EBI-10292253, EBI-357085;
-!- SUBCELLULAR LOCATION: Secreted {ECO:0000250}. Cell junction,
synapse {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=6;
Name=1;
IsoId=Q96PB7-1; Sequence=Displayed;
Name=2;
IsoId=Q96PB7-2; Sequence=VSP_003771, VSP_003772;
Name=3;
IsoId=Q96PB7-3; Sequence=VSP_003769;
Name=4;
IsoId=Q96PB7-4; Sequence=VSP_003769, VSP_003771, VSP_003772;
Name=5;
IsoId=Q96PB7-5; Sequence=VSP_003770;
Name=6;
IsoId=Q96PB7-6; Sequence=VSP_003770, VSP_003771, VSP_003772;
-!- TISSUE SPECIFICITY: In the eye, expressed in trabecular meshwork
and neural retina; in non-ocular tissues, expressed in brain and
lung. {ECO:0000269|PubMed:12019210}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF397392; AAK97473.1; -; mRNA.
EMBL; AF397393; AAK97474.1; -; mRNA.
EMBL; AF397394; AAK97475.1; -; mRNA.
EMBL; AF397395; AAK97476.1; -; mRNA.
EMBL; AF397396; AAK97477.1; -; mRNA.
EMBL; AF397397; AAK97478.1; -; mRNA.
EMBL; AY358722; AAQ89084.1; -; mRNA.
EMBL; AK095724; BAG53115.1; -; mRNA.
EMBL; AL356280; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL359760; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471097; EAW72922.1; -; Genomic_DNA.
EMBL; BC022531; AAH22531.1; -; mRNA.
EMBL; BK001429; DAA01551.1; -; Genomic_DNA.
EMBL; BK001429; DAA01553.1; -; Genomic_DNA.
EMBL; BK001429; DAA01554.1; -; Genomic_DNA.
EMBL; BK001429; DAA01555.1; -; Genomic_DNA.
EMBL; BK001429; DAA01556.1; -; Genomic_DNA.
CCDS; CCDS30781.1; -. [Q96PB7-3]
CCDS; CCDS72832.1; -. [Q96PB7-1]
RefSeq; NP_001275750.1; NM_001288821.1. [Q96PB7-1]
RefSeq; NP_001275752.1; NM_001288823.1. [Q96PB7-5]
RefSeq; NP_477518.2; NM_058170.3. [Q96PB7-3]
RefSeq; XP_016855729.1; XM_017000240.1. [Q96PB7-5]
UniGene; Hs.484475; -.
ProteinModelPortal; Q96PB7; -.
SMR; Q96PB7; -.
BioGrid; 125601; 10.
IntAct; Q96PB7; 6.
STRING; 9606.ENSP00000359121; -.
iPTMnet; Q96PB7; -.
PhosphoSitePlus; Q96PB7; -.
DMDM; 20139068; -.
PaxDb; Q96PB7; -.
PeptideAtlas; Q96PB7; -.
PRIDE; Q96PB7; -.
DNASU; 118427; -.
Ensembl; ENST00000338858; ENSP00000345192; ENSG00000118733. [Q96PB7-1]
Ensembl; ENST00000370103; ENSP00000359121; ENSG00000118733. [Q96PB7-3]
Ensembl; ENST00000536598; ENSP00000443471; ENSG00000118733. [Q96PB7-6]
GeneID; 118427; -.
KEGG; hsa:118427; -.
UCSC; uc001duf.4; human. [Q96PB7-1]
CTD; 118427; -.
DisGeNET; 118427; -.
EuPathDB; HostDB:ENSG00000118733.16; -.
GeneCards; OLFM3; -.
H-InvDB; HIX0000823; -.
HGNC; HGNC:17990; OLFM3.
HPA; HPA050297; -.
MIM; 607567; gene.
neXtProt; NX_Q96PB7; -.
OpenTargets; ENSG00000118733; -.
PharmGKB; PA31917; -.
eggNOG; ENOG410INP6; Eukaryota.
eggNOG; ENOG410ZVS0; LUCA.
GeneTree; ENSGT00760000119005; -.
HOGENOM; HOG000232069; -.
HOVERGEN; HBG061751; -.
InParanoid; Q96PB7; -.
OMA; VMKSWNT; -.
OrthoDB; EOG091G05HN; -.
PhylomeDB; Q96PB7; -.
TreeFam; TF315964; -.
ChiTaRS; OLFM3; human.
GeneWiki; OLFM3; -.
GenomeRNAi; 118427; -.
PRO; PR:Q96PB7; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000118733; -.
CleanEx; HS_OLFM3; -.
ExpressionAtlas; Q96PB7; baseline and differential.
Genevisible; Q96PB7; HS.
GO; GO:0032281; C:AMPA glutamate receptor complex; IEA:Ensembl.
GO; GO:0030054; C:cell junction; IEA:UniProtKB-KW.
GO; GO:0005615; C:extracellular space; IEA:Ensembl.
GO; GO:0005794; C:Golgi apparatus; IEA:Ensembl.
GO; GO:0045202; C:synapse; IEA:UniProtKB-SubCell.
GO; GO:0042462; P:eye photoreceptor cell development; IEA:Ensembl.
InterPro; IPR031216; Noelin-3.
InterPro; IPR022082; Noelin_dom.
InterPro; IPR003112; Olfac-like_dom.
InterPro; IPR011044; Quino_amine_DH_bsu.
PANTHER; PTHR23192:SF36; PTHR23192:SF36; 1.
Pfam; PF12308; Noelin-1; 1.
Pfam; PF02191; OLF; 1.
SMART; SM00284; OLF; 1.
SUPFAM; SSF50969; SSF50969; 3.
PROSITE; PS51132; OLF; 1.
1: Evidence at protein level;
Alternative splicing; Cell junction; Coiled coil; Complete proteome;
Disulfide bond; Glycoprotein; Reference proteome; Secreted; Signal;
Synapse.
SIGNAL 1 23 {ECO:0000255}.
CHAIN 24 478 Noelin-3.
/FTId=PRO_0000020080.
DOMAIN 218 470 Olfactomedin-like. {ECO:0000255|PROSITE-
ProRule:PRU00446}.
COILED 77 217 {ECO:0000255}.
CARBOHYD 33 33 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 95 95 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 179 179 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 299 299 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 465 465 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 219 401 {ECO:0000255|PROSITE-ProRule:PRU00446}.
VAR_SEQ 1 95 Missing (in isoform 5 and isoform 6).
{ECO:0000303|Ref.1}.
/FTId=VSP_003770.
VAR_SEQ 1 43 MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSTPD
TL -> MQATSNLLNLLLLSLFAGLDPSK (in isoform
3 and isoform 4).
{ECO:0000303|PubMed:15489334,
ECO:0000303|Ref.1}.
/FTId=VSP_003769.
VAR_SEQ 218 235 TCGKLMKITGPVTVKTSG -> IDLKKRKEEEKRQQKGEA
(in isoform 2, isoform 4 and isoform 6).
{ECO:0000303|Ref.1}.
/FTId=VSP_003771.
VAR_SEQ 236 478 Missing (in isoform 2, isoform 4 and
isoform 6). {ECO:0000303|Ref.1}.
/FTId=VSP_003772.
CONFLICT 88 88 Q -> K (in Ref. 6; AAH22531).
{ECO:0000305}.
CONFLICT 454 454 Y -> C (in Ref. 6; AAH22531).
{ECO:0000305}.
SEQUENCE 478 AA; 54930 MW; 02EAAF58741489E5 CRC64;
MSPPLLKLGA VLSTMAMISN WMSQTLPSLV GLNTTRLSTP DTLTQISPKE GWQVYSSAQD
PDGRCICTVV APEQNLCSRD AKSRQLRQLL EKVQNMSQSI EVLNLRTQRD FQYVLKMETQ
MKGLKAKFRQ IEDDRKTLMT KHFQELKEKM DELLPLIPVL EQYKTDAKLI TQFKEEIRNL
SAVLTGIQEE IGAYDYEELH QRVLSLETRL RDCMKKLTCG KLMKITGPVT VKTSGTRFGA
WMTDPLASEK NNRVWYMDSY TNNKIVREYK SIADFVSGAE SRTYNLPFKW AGTNHVVYNG
SLYFNKYQSN IIIKYSFDMG RVLAQRSLEY AGFHNVYPYT WGGFSDIDLM ADEIGLWAVY
ATNQNAGNIV ISQLNQDTLE VMKSWSTGYP KRSAGESFMI CGTLYVTNSH LTGAKVYYSY
STKTSTYEYT DIPFHNQYFH ISMLDYNARD RALYAWNNGH QVLFNVTLFH IIKTEDDT


Related products :

Catalog number Product name Quantity
EIAAB27475 Mouse,Mus musculus,Noe3,Noelin-3,Olfactomedin-3,Olfm3,Optimedin
EIAAB27474 Noe3,Noelin-3,Olfactomedin-3,Olfm3,Optimedin,Rat,Rattus norvegicus
EIAAB27473 Homo sapiens,Human,NOE3,Noelin-3,Olfactomedin-3,OLFM3,Optimedin,UNQ1924_PRO4399
EIAAB27469 Homo sapiens,Human,Neuronal olfactomedin-related ER localized protein,NOE1,NOEL1,Noelin,Olfactomedin-1,OLFM1
EIAAB27468 Mouse,Mus musculus,Neuronal olfactomedin-related ER localized protein,Noe1,Noel,Noel1,Noelin,Olfactomedin-1,Olfm1,Pancortin
EIAAB27470 1B426B,D2Sut1e,Neuronal olfactomedin-related ER localized protein,Noe1,Noel,Noel1,Noelin,Olfactomedin-1,Olfm1,Pancortin,Rat,Rattus norvegicus
EIAAB28816 Chicken,Gallus gallus,Olfactomedin-like protein 3,Olfactomedin-noelin-tiarin factor 1,OLFML3,ONT1
EIAAB27467 Chicken,Gallus gallus,Neuronal olfactomedin-related ER localized protein,NOEL,NOEL1,Noelin,Olfactomedin-1,OLFM1,Pancortin
EIAAB27471 Mouse,Mus musculus,Noelin-2,Olfactomedin-2,Olfm2
EIAAB27472 Homo sapiens,Human,NOE2,Noelin-2,Olfactomedin-2,OLFM2
Olfm-101AP Noelin-1 Olfactomedin-1) antibodies Polyclonal anbtibody Host: Rabbit Affinity purifed 200ul
Olfm-101AP Noelin-1 Olfactomedin-1) antibodies WB control: PC-Olfm Host: Rabbit Affinity purifed 100-150ul
Olfm-101AP Noelin-1 Olfactomedin-1) antibodies Antigenic peptide: P-Olfm Host: Rabbit Affinity purifed 100ul
Olfm-101AP Noelin-1 Olfactomedin-1) antibodies FITC-conjugates: Olfm-FITC Host: Rabbit Affinity purifed 200ul
Olfm-101AP Noelin-1 Olfactomedin-1) antibodies Biotin Conjugates: Olfm-Biotin Host: Rabbit Affinity purifed 200ul
orb91320 Human Noelin 1 gene Human Noelin 1 gene is a cDNA gene. For research use only. 10
YF-MA19783 anti-Optimedin (3A2) 100 ug
YF-PA26841 anti-Optimedin 50 ul
NBL1-13927 Optimedin Lysate 0.1 mg
YF-MA19782 anti-Optimedin (1F11) 100 ug
bs-11061R Rabbit Anti-OLFM3-Optimedin Polyclonal Antibody 100ul
bs-11061R-Cy7 Rabbit Anti-OLFM3-Optimedin Polyclonal Antibody, Cy7 Conjugated 100ul
YF-PA26841 anti-Optimedin type: Primary antibodies host: Mouse 50 ul
bs-11061R-Cy3 Rabbit Anti-OLFM3-Optimedin Polyclonal Antibody, Cy3 Conjugated 100ul
bs-11061R-Cy5.5 Rabbit Anti-OLFM3-Optimedin Polyclonal Antibody, Cy5.5 Conjugated 100ul


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur