Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Non-centrosomal microtubule array protein 1

 NOCA1_CAEEL             Reviewed;         922 AA.
G5EEK3; A0A0M3UPV7; G5EBN2; G5EBP7; G5EC74; G5EE58; N1NSE8; Q8I4G1;
Q9XVL5;
11-MAY-2016, integrated into UniProtKB/Swiss-Prot.
14-DEC-2011, sequence version 1.
18-JUL-2018, entry version 54.
RecName: Full=Non-centrosomal microtubule array protein 1 {ECO:0000312|WormBase:T09E8.1c};
Name=noca-1 {ECO:0000312|WormBase:T09E8.1c};
ORFNames=T09E8.1 {ECO:0000312|WormBase:T09E8.1c};
Caenorhabditis elegans.
Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
NCBI_TaxID=6239 {ECO:0000312|Proteomes:UP000001940};
[1] {ECO:0000305}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM H), FUNCTION, SUBCELLULAR
LOCATION, DEVELOPMENTAL STAGE, AND DISRUPTION PHENOTYPE.
PubMed=26371552; DOI=10.7554/eLife.08649;
Wang S., Wu D., Quintin S., Green R.A., Cheerambathur D.K.,
Ochoa S.D., Desai A., Oegema K.;
"NOCA-1 Functions with gamma-tubulin and in parallel to Patronin to
assemble non-centrosomal microtubule arrays in C. elegans.";
Elife 4:E08649-E08649(2015).
[2] {ECO:0000312|Proteomes:UP000001940}
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=Bristol N2 {ECO:0000312|Proteomes:UP000001940};
PubMed=9851916; DOI=10.1126/science.282.5396.2012;
The C. elegans sequencing consortium;
"Genome sequence of the nematode C. elegans: a platform for
investigating biology.";
Science 282:2012-2018(1998).
[3] {ECO:0000305}
FUNCTION, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE, AND DISRUPTION
PHENOTYPE.
PubMed=26586219; DOI=10.1242/dev.126615;
Quintin S., Wang S., Pontabry J., Bender A., Robin F., Hyenne V.,
Landmann F., Gally C., Oegema K., Labouesse M.;
"Non-centrosomal epidermal microtubules act in parallel to LET-
502/ROCK to promote C. elegans elongation.";
Development 143:160-173(2016).
-!- FUNCTION: Plays a role in the assembly of microtubule arrays in
the germline acting redundantly with ptrn-1 to control
circumferential microtubule assembly along the body which is
necessary for larval development, viability, and morphology and
integrity of the epidermis (PubMed:26371552). Required for
microtubule stability and anchorage by binding to microtubule
minus ends (PubMed:26371552). Recruited to hemidesomosomes in
early embryonic elongation to direct the nucleation and growth of
non-centrosomal microtubules (PubMed:26586219).
{ECO:0000269|PubMed:26371552, ECO:0000269|PubMed:26586219}.
-!- FUNCTION: Isoform b: Required for normal nuclear migration in the
embryonic epidermis. {ECO:0000269|PubMed:26371552}.
-!- FUNCTION: Isoform h: Directs the assembly of non-centrosomal
microtubule arrays that determine the position of nuclei within
intracellular compartments in the epidermis and this is
independent of ptrn-1 activity. {ECO:0000269|PubMed:26371552}.
-!- SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton
{ECO:0000269|PubMed:26371552}. Apical cell membrane
{ECO:0000269|PubMed:26371552}. Cell junction, hemidesmosome
{ECO:0000269|PubMed:26586219}. Cell junction, adherens junction
{ECO:0000269|PubMed:26586219}. Note=Isoform h: Co-localizes with
gamma-tubulin to the apical cell membrane.
{ECO:0000269|PubMed:26371552}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=9;
Name=c {ECO:0000312|WormBase:T09E8.1c};
IsoId=G5EEK3-1; Sequence=Displayed;
Name=a {ECO:0000312|WormBase:T09E8.1a};
IsoId=G5EEK3-2; Sequence=VSP_058278;
Name=b {ECO:0000312|WormBase:T09E8.1b};
IsoId=G5EEK3-3; Sequence=VSP_058279;
Name=d {ECO:0000312|WormBase:T09E8.1d};
IsoId=G5EEK3-4; Sequence=VSP_058274;
Name=e {ECO:0000312|WormBase:T09E8.1e};
IsoId=G5EEK3-5; Sequence=VSP_058275;
Name=f {ECO:0000312|WormBase:T09E8.1f};
IsoId=G5EEK3-6; Sequence=VSP_058280;
Name=g {ECO:0000312|WormBase:T09E8.1g};
IsoId=G5EEK3-7; Sequence=VSP_058276;
Name=h {ECO:0000312|WormBase:T09E8.1h};
IsoId=G5EEK3-8; Sequence=VSP_058281;
Name=i {ECO:0000312|WormBase:T09E8.1i};
IsoId=G5EEK3-9; Sequence=VSP_058277, VSP_058282;
Note=No experimental confirmation available. {ECO:0000305};
-!- DEVELOPMENTAL STAGE: First expressed in between seam cells at the
lima-bean stage of embryogenesis (PubMed:26586219). Expressed in
the embryonic epidermis and in puncta in the epidermal syncytium
and also in between the epidermal body syncytium and the seam
cells of larvae (PubMed:26371552). {ECO:0000269|PubMed:26371552,
ECO:0000269|PubMed:26586219}.
-!- DISRUPTION PHENOTYPE: Isoform b: Deletion results in slower
embryonic development, mutants that are 5% shorter than their
wild-type conterparts, and also leads to the prevention of nuclear
migration in the embryonic epidermis (PubMed:26371552,
PubMed:26586219). RNAi-mediated knockdown results in fragmentation
of the cadherin-based junctional complex in embryos and
intermediate filaments display a diffuse pattern in older embryos
(PubMed:26586219). RNAi-mediated knockdown of isoform h results in
disrupted germline architecture and sterility (PubMed:26371552).
{ECO:0000269|PubMed:26371552, ECO:0000269|PubMed:26586219}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; KT722731; ALF12299.1; -; mRNA.
EMBL; BX284605; CAB03162.1; -; Genomic_DNA.
EMBL; BX284605; CAB54298.2; -; Genomic_DNA.
EMBL; BX284605; CAB54297.2; -; Genomic_DNA.
EMBL; BX284605; CAD54154.1; -; Genomic_DNA.
EMBL; BX284605; CAD54155.2; -; Genomic_DNA.
EMBL; BX284605; CAD54156.2; -; Genomic_DNA.
EMBL; BX284605; CAJ80826.1; -; Genomic_DNA.
EMBL; BX284605; CCW45976.1; -; Genomic_DNA.
EMBL; BX284605; CUR30005.1; -; Genomic_DNA.
PIR; T23293; T23293.
PIR; T23295; T23295.
PIR; T23296; T23296.
RefSeq; NP_001041165.1; NM_001047700.2. [G5EEK3-6]
RefSeq; NP_001294691.1; NM_001307762.1. [G5EEK3-7]
RefSeq; NP_001303706.1; NM_001316777.1. [G5EEK3-8]
RefSeq; NP_506274.1; NM_073873.1. [G5EEK3-9]
RefSeq; NP_506275.2; NM_073874.4. [G5EEK3-3]
RefSeq; NP_506276.2; NM_073875.4. [G5EEK3-2]
RefSeq; NP_872199.2; NM_182399.5. [G5EEK3-1]
RefSeq; NP_872200.1; NM_182400.4. [G5EEK3-4]
RefSeq; NP_872201.2; NM_182401.2. [G5EEK3-5]
UniGene; Cel.18157; -.
UniGene; Cel.33127; -.
SMR; G5EEK3; -.
IntAct; G5EEK3; 4.
STRING; 6239.T09E8.1c; -.
EPD; G5EEK3; -.
PaxDb; G5EEK3; -.
PeptideAtlas; G5EEK3; -.
EnsemblMetazoa; T09E8.1c; T09E8.1c; WBGene00011647. [G5EEK3-1]
GeneID; 3565610; -.
KEGG; cel:CELE_T09E8.1; -.
UCSC; K03H4.2; c. elegans.
UCSC; T09E8.1c; c. elegans.
CTD; 3565610; -.
WormBase; T09E8.1a; CE31987; WBGene00011647; noca-1. [G5EEK3-2]
WormBase; T09E8.1b; CE31988; WBGene00011647; noca-1. [G5EEK3-3]
WormBase; T09E8.1c; CE41451; WBGene00011647; noca-1. [G5EEK3-1]
WormBase; T09E8.1d; CE31990; WBGene00011647; noca-1. [G5EEK3-4]
WormBase; T09E8.1e; CE47381; WBGene00011647; noca-1. [G5EEK3-5]
WormBase; T09E8.1f; CE39958; WBGene00011647; noca-1. [G5EEK3-6]
WormBase; T09E8.1g; CE48378; WBGene00011647; noca-1. [G5EEK3-7]
WormBase; T09E8.1h; CE51088; WBGene00011647; noca-1. [G5EEK3-8]
WormBase; T09E8.1i; CE11698; WBGene00011647; noca-1. [G5EEK3-9]
eggNOG; ENOG410JM0P; Eukaryota.
eggNOG; ENOG41115WC; LUCA.
HOGENOM; HOG000018947; -.
InParanoid; G5EEK3; -.
OMA; NRATPID; -.
OrthoDB; EOG091G036F; -.
PRO; PR:G5EEK3; -.
Proteomes; UP000001940; Chromosome V.
Bgee; WBGene00010549; -.
GO; GO:0005912; C:adherens junction; IEA:UniProtKB-SubCell.
GO; GO:0016324; C:apical plasma membrane; IEA:UniProtKB-SubCell.
GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-KW.
GO; GO:0005856; C:cytoskeleton; IEA:UniProtKB-SubCell.
GO; GO:0030056; C:hemidesmosome; IEA:UniProtKB-SubCell.
GO; GO:0031122; P:cytoplasmic microtubule organization; IGI:WormBase.
GO; GO:0007281; P:germ cell development; IMP:WormBase.
GO; GO:0002119; P:nematode larval development; IGI:WormBase.
2: Evidence at transcript level;
Alternative splicing; Cell junction; Cell membrane; Coiled coil;
Complete proteome; Cytoplasm; Cytoskeleton; Membrane;
Reference proteome.
CHAIN 1 922 Non-centrosomal microtubule array protein
1. {ECO:0000305}.
/FTId=PRO_0000436174.
COILED 564 728 {ECO:0000255}.
COMPBIAS 74 189 Ser-rich. {ECO:0000255|PROSITE-
ProRule:PRU00016}.
VAR_SEQ 1 456 MSNERVSTGSLGERLMLRTRSTRGSVRETLSKAIRSTLGRA
SSMERKDMPDRPKYGTALTAMTSTTPPSPKDRSSDSGDGDS
PRPRKFSSKECARIYFSNTSSEHSSRSNSSTPRRVRHTTAS
SGYGSLSHLPPISYRKSSDPLNSLMSQSMYVQSPGMHIDEP
KCTSLSQRRLYYEDSSETYIPSSPSLTTLKDFMMTNDDETF
DDFDFDNDDVKSVISSASTSRIFSVDNRMSKYQKNQSLRQF
LNSPVRLRKRGDTSRRDAVEAGFEPRDTVPRCHSTQSLRDV
QRVRSYNNSQFQASDLSLNPNGSIRAACDSTSGSVAPTAVV
NPARNHVISHRQQHHTSYEKDLIPHHNIDVDRRRSLQALNG
SSALYQLNNGGSPNGVRSQFSPSDLSIHTPVHHVGSRVRVS
SVNQICDSNSAPQFSIDQRRSVHNIGNPVRNSFVDGIKTTS
TPKNQ -> MNICCCGGAMGRFYTKMIERLTGGGSPTSDQN
GNSHHHHHHLPPAPRHLSSSHHQIETISGSSKLRAQSGSPA
LNRKKRPE (in isoform d). {ECO:0000305}.
/FTId=VSP_058274.
VAR_SEQ 1 427 MSNERVSTGSLGERLMLRTRSTRGSVRETLSKAIRSTLGRA
SSMERKDMPDRPKYGTALTAMTSTTPPSPKDRSSDSGDGDS
PRPRKFSSKECARIYFSNTSSEHSSRSNSSTPRRVRHTTAS
SGYGSLSHLPPISYRKSSDPLNSLMSQSMYVQSPGMHIDEP
KCTSLSQRRLYYEDSSETYIPSSPSLTTLKDFMMTNDDETF
DDFDFDNDDVKSVISSASTSRIFSVDNRMSKYQKNQSLRQF
LNSPVRLRKRGDTSRRDAVEAGFEPRDTVPRCHSTQSLRDV
QRVRSYNNSQFQASDLSLNPNGSIRAACDSTSGSVAPTAVV
NPARNHVISHRQQHHTSYEKDLIPHHNIDVDRRRSLQALNG
SSALYQLNNGGSPNGVRSQFSPSDLSIHTPVHHVGSRVRVS
SVNQICDSNSAPQFSID -> MSLVSGKTESSARWSIRPSC
SCNDSLFTISDTECSEIEADMRRKDRHNWKKS (in
isoform e). {ECO:0000305}.
/FTId=VSP_058275.
VAR_SEQ 1 370 MSNERVSTGSLGERLMLRTRSTRGSVRETLSKAIRSTLGRA
SSMERKDMPDRPKYGTALTAMTSTTPPSPKDRSSDSGDGDS
PRPRKFSSKECARIYFSNTSSEHSSRSNSSTPRRVRHTTAS
SGYGSLSHLPPISYRKSSDPLNSLMSQSMYVQSPGMHIDEP
KCTSLSQRRLYYEDSSETYIPSSPSLTTLKDFMMTNDDETF
DDFDFDNDDVKSVISSASTSRIFSVDNRMSKYQKNQSLRQF
LNSPVRLRKRGDTSRRDAVEAGFEPRDTVPRCHSTQSLRDV
QRVRSYNNSQFQASDLSLNPNGSIRAACDSTSGSVAPTAVV
NPARNHVISHRQQHHTSYEKDLIPHHNIDVDRRRSLQALNG
S -> MQSIREPRSVELRESNKFMRSISHGRASTWRRNRIR
PDNQLSA (in isoform g). {ECO:0000305}.
/FTId=VSP_058276.
VAR_SEQ 1 264 MSNERVSTGSLGERLMLRTRSTRGSVRETLSKAIRSTLGRA
SSMERKDMPDRPKYGTALTAMTSTTPPSPKDRSSDSGDGDS
PRPRKFSSKECARIYFSNTSSEHSSRSNSSTPRRVRHTTAS
SGYGSLSHLPPISYRKSSDPLNSLMSQSMYVQSPGMHIDEP
KCTSLSQRRLYYEDSSETYIPSSPSLTTLKDFMMTNDDETF
DDFDFDNDDVKSVISSASTSRIFSVDNRMSKYQKNQSLRQF
LNSPVRLRKRGDTSRRDA -> MLKQLLALTCMHKKDKNKL
AITAGTAECSNRSPQNSPGSSSEGAADESLNQSVAIPEEAH
LNTSQFISLPLSDVSFEAAASQNRATPIDFGTREVKEDDDV
LSDTGRRRSVNLITPSPIPEETEDNLTETPIPVVEHIPRSA
IFEPFNHENSPLFSVKARKKAHEYRSNDSTLSPSSSSNNDD
SIRIDSIRVRSSKSATNNQLKGRLTPILGGSLRPIPKKRNR
VAFNGNSTFVAPERLCLEVDKIHQDRCRFSFVLTLCVPYA
(in isoform i). {ECO:0000305}.
/FTId=VSP_058277.
VAR_SEQ 1 251 MSNERVSTGSLGERLMLRTRSTRGSVRETLSKAIRSTLGRA
SSMERKDMPDRPKYGTALTAMTSTTPPSPKDRSSDSGDGDS
PRPRKFSSKECARIYFSNTSSEHSSRSNSSTPRRVRHTTAS
SGYGSLSHLPPISYRKSSDPLNSLMSQSMYVQSPGMHIDEP
KCTSLSQRRLYYEDSSETYIPSSPSLTTLKDFMMTNDDETF
DDFDFDNDDVKSVISSASTSRIFSVDNRMSKYQKNQSLRQF
LNSPV -> MCLVCAGCKVLSTLRAYCTGFMPNITVIIAPK
KVLTSNSSSSTSDISMHRSIPEIYVPNDKYNEEKPIRRKSH
GNI (in isoform a). {ECO:0000305}.
/FTId=VSP_058278.
VAR_SEQ 1 250 MSNERVSTGSLGERLMLRTRSTRGSVRETLSKAIRSTLGRA
SSMERKDMPDRPKYGTALTAMTSTTPPSPKDRSSDSGDGDS
PRPRKFSSKECARIYFSNTSSEHSSRSNSSTPRRVRHTTAS
SGYGSLSHLPPISYRKSSDPLNSLMSQSMYVQSPGMHIDEP
KCTSLSQRRLYYEDSSETYIPSSPSLTTLKDFMMTNDDETF
DDFDFDNDDVKSVISSASTSRIFSVDNRMSKYQKNQSLRQF
LNSP -> MASLCNSIIGWIKNDKE (in isoform b).
{ECO:0000305}.
/FTId=VSP_058279.
VAR_SEQ 1 250 MSNERVSTGSLGERLMLRTRSTRGSVRETLSKAIRSTLGRA
SSMERKDMPDRPKYGTALTAMTSTTPPSPKDRSSDSGDGDS
PRPRKFSSKECARIYFSNTSSEHSSRSNSSTPRRVRHTTAS
SGYGSLSHLPPISYRKSSDPLNSLMSQSMYVQSPGMHIDEP
KCTSLSQRRLYYEDSSETYIPSSPSLTTLKDFMMTNDDETF
DDFDFDNDDVKSVISSASTSRIFSVDNRMSKYQKNQSLRQF
LNSP -> MLQPPSPRLGKRNIIKNVT (in isoform
f). {ECO:0000305}.
/FTId=VSP_058280.
VAR_SEQ 2 251 SNERVSTGSLGERLMLRTRSTRGSVRETLSKAIRSTLGRAS
SMERKDMPDRPKYGTALTAMTSTTPPSPKDRSSDSGDGDSP
RPRKFSSKECARIYFSNTSSEHSSRSNSSTPRRVRHTTASS
GYGSLSHLPPISYRKSSDPLNSLMSQSMYVQSPGMHIDEPK
CTSLSQRRLYYEDSSETYIPSSPSLTTLKDFMMTNDDETFD
DFDFDNDDVKSVISSASTSRIFSVDNRMSKYQKNQSLRQFL
NSPV -> LKQLLALTCMHKKDKNKLAITAGTAECSNRSPQ
NSPGSSSEGAADESLNQSVAIPEEAHLNTSQFISLPLSDVS
FEAAASQNRATPIDFGTREVKEDDDVLSDTGRRRSVNLITP
SPIPEETEDNLTETPIPVVEHIPRSAIFEPFNHENSPLFSV
KARKKAHEYRSNDSTLSPSSSSNNDDSIRIDSIRVRSSKSA
TNNQLKGRLTPILGGSLRPIPKKRNRVAFNGNSTFVAPERL
CLEVDKIHQDRF (in isoform h).
{ECO:0000305}.
/FTId=VSP_058281.
VAR_SEQ 265 922 Missing (in isoform i). {ECO:0000305}.
/FTId=VSP_058282.
SEQUENCE 922 AA; 103684 MW; 920C15936BAEDC1B CRC64;
MSNERVSTGS LGERLMLRTR STRGSVRETL SKAIRSTLGR ASSMERKDMP DRPKYGTALT
AMTSTTPPSP KDRSSDSGDG DSPRPRKFSS KECARIYFSN TSSEHSSRSN SSTPRRVRHT
TASSGYGSLS HLPPISYRKS SDPLNSLMSQ SMYVQSPGMH IDEPKCTSLS QRRLYYEDSS
ETYIPSSPSL TTLKDFMMTN DDETFDDFDF DNDDVKSVIS SASTSRIFSV DNRMSKYQKN
QSLRQFLNSP VRLRKRGDTS RRDAVEAGFE PRDTVPRCHS TQSLRDVQRV RSYNNSQFQA
SDLSLNPNGS IRAACDSTSG SVAPTAVVNP ARNHVISHRQ QHHTSYEKDL IPHHNIDVDR
RRSLQALNGS SALYQLNNGG SPNGVRSQFS PSDLSIHTPV HHVGSRVRVS SVNQICDSNS
APQFSIDQRR SVHNIGNPVR NSFVDGIKTT STPKNQIAVA PLAHKSRHLS ESRDEMRGGA
ERRGSGGQMN LPAYTNYLIR HSGEERLVDG PVTNASDARI AYLEKRIREL ELTQKEQSSH
STPSQSRHSS SKSSHFNGSS NLSTSEQLRL QEMSDELANK DRKVTSLESK LLKAYQRIER
LNEEYDGKIK NLMYDSERAR DDLTRCVDKI QQLENELDET RAAVQNGDHA NEQEYHELRD
KIWKQERELQ ESRTLLTRLR EKEAEFERMR SEKGYLELKN ENLNKKLEAK KRAVEELERS
VSTLRLEQTI CQQSCSSGST PLADEMEIMS DIRPSLARPY TKAHSTLGSH NMSPLSHSKS
SGLTKSFSNF ALNSSKQRDD ITANMSRSIR EQNRHITMCR AMVVCLKDTV DRMARGENPD
VARLLGVKLN VMSESEMEDD EDHEADASQP FSMMSAESAL SKQCGKLADL DKDLDTIRCQ
LADWHGQTNA EGDGDRDVCR VQ


Related products :

Catalog number Product name Quantity
EIAAB08871 250 kDa centrosomal protein,Centrosomal Nek2-associated protein 1,Centrosomal protein 2,Centrosome-associated protein CEP250,Cep2,Cep250,Cep250,C-Nap1,Inmp,Intranuclear matrix protein,Mouse,Mus muscul
EIAAB08872 250 kDa centrosomal protein,Centrosomal Nek2-associated protein 1,Centrosomal protein 2,Centrosome-associated protein CEP250,CEP2,Cep250,CEP250,CNAP1,C-Nap1,Homo sapiens,Human
25-799 PPP4R2 is the regulatory subunit of serine_threonine-protein phosphatase 4 (PP4). It may regulate the activity of PPP4C at centrosomal microtubule organizing centers. Its interaction with the SMN comp 0.05 mg
EIAAB06679 C6orf182,Centrosomal protein 57kDa-like protein 1,Centrosomal protein CEP57L1,Centrosomal protein of 57 kDa-related protein,CEP57L1,Cep57R,CEP57R,Cep57-related protein,Homo sapiens,Human
EIAAB06681 Centrosomal protein 57kDa-like protein 1,Centrosomal protein CEP57L1,Centrosomal protein of 57 kDa-related protein,Cep57l1,Cep57R,Cep57r,Cep57-related protein,Rat,Rattus norvegicus
EIAAB06680 Centrosomal protein 57kDa-like protein 1,Centrosomal protein CEP57L1,Centrosomal protein of 57 kDa-related protein,Cep57l1,Cep57R,Cep57r,Cep57-related protein,Mouse,Mus musculus
EIAAB08340 Centriolin,Centrosomal protein 1,Centrosomal protein of 110 kDa,CEP1,Cep110,CEP110,CNTRL,Homo sapiens,Human
EIAAB08339 Centriolin,Centrosomal protein 1,Centrosomal protein of 110 kDa,Cep1,Cep110,Cep110,Cntrl,Mouse,Mus musculus
EIAAB08838 Centrosomal protein 4,Centrosomal protein of 135 kDa,Cep135,CEP135,CEP4,Homo sapiens,Human,KIAA0635
EIAAB08839 Centrosomal protein 4,Centrosomal protein of 135 kDa,Cep135,Cep135,Cep4,Kiaa0635,Mouse,Mus musculus
EIAAB35342 Fam82b,Microtubule-associated protein,Mouse,mRMD-1,Mus musculus,Protein FAM82B,Regulator of microtubule dynamics protein 1,RMD-1
EIAAB25789 Cardiac zipper protein,CAZIP,Homo sapiens,Human,KIAA0774,Microtubule plus-end tracking protein TIP150,Microtubule-associated tumor suppressor candidate 2,MTUS2,TIP150,Tracking protein of 150 kDa
EIAAB25788 Cardiac zipper protein,Cazip,Kiaa0774,Microtubule plus-end tracking protein TIP150,Microtubule-associated tumor suppressor candidate 2 homolog,Mouse,Mtus2,Mus musculus,Tip150,Tracking protein of 150 k
EIAAB12889 Echinoderm microtubule-associated protein-like 5-like,Echinoderm microtubule-associated protein-like 6,EMAP-6,EML5L,EML6,Homo sapiens,Human
EIAAB12890 Echinoderm microtubule-associated protein-like 5-like,Echinoderm microtubule-associated protein-like 6,EMAP-6,Eml5l,Eml6,Mouse,Mus musculus
6242-0039 RABBIT ANTI BOVINE MICROTUBULE ASSOCIATED PROTEIN 2 (+ TAU), Product Type Polyclonal Antibody, Specificity MICROTUBULE ASSOCIATED PROTEIN 2 , Target Species Bovine, Host Rabbit, Format Purified, 0.2 ml
SCH-6242-0039 RABBIT ANTI BOVINE MICROTUBULE ASSOCIATED PROTEIN 2 (+ TAU), Product Type Polyclonal Antibody, Specificity MICROTUBULE ASSOCIATED PROTEIN 2 , Target Species Bovine, Host Rabbit, Format Purified, 0.2 ml
6242-0206 MOUSE ANTI BOVINE MICROTUBULE ASSOCIATED PROTEIN TAU, Product Type Monoclonal Antibody, Specificity MICROTUBULE ASSOCIATED PROTEIN TAU, Target Species Bovine, Host Mouse, Format Ascites, Isotypes 0.1 ml
SCH-6242-0206 MOUSE ANTI BOVINE MICROTUBULE ASSOCIATED PROTEIN TAU, Product Type Monoclonal Antibody, Specificity MICROTUBULE ASSOCIATED PROTEIN TAU, Target Species Bovine, Host Mouse, Format Ascites, Isotypes 0.1 ml
H1234703 Total RNA Array _ Human Adult and Fetal Normal Tissue, Array III (Array I + Array II, 96 Spots) 2 arrays
H1234703 Total RNA Array _ Human Adult and Fetal Normal Tissue, Array III (Array I + Array II, 96 Spots) 2 arrays
EIAAB06777 CENPJ,CENP-J,Centromere protein J,Centrosomal P4.1-associated protein,CPAP,Homo sapiens,Human,LAG-3-associated protein,LAP,LIP1,LYST-interacting protein 1
5083 Centrosomal protein 164 0.1 mg
5083 Centrosomal protein 164 0.5 mg
EIAAB06866 Ccdc45,Centrosomal protein of 95 kDa,Cep95,Coiled-coil domain-containing protein 45,Mouse,Mus musculus


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur