Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Outer envelope pore protein 37, chloroplastic (Chloroplastic outer envelope pore protein of 37 kDa) (AtOEP37)

 OEP37_ARATH             Reviewed;         343 AA.
O80565; F4IT23; F4IT24; Q94AM0;
22-FEB-2012, integrated into UniProtKB/Swiss-Prot.
01-JUN-2002, sequence version 2.
20-JUN-2018, entry version 102.
RecName: Full=Outer envelope pore protein 37, chloroplastic;
AltName: Full=Chloroplastic outer envelope pore protein of 37 kDa;
Short=AtOEP37;
Flags: Precursor;
Name=OEP37; OrderedLocusNames=At2g43950; ORFNames=F6E13.8;
Arabidopsis thaliana (Mouse-ear cress).
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae;
Arabidopsis.
NCBI_TaxID=3702;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=cv. Columbia;
PubMed=10617197; DOI=10.1038/45471;
Lin X., Kaul S., Rounsley S.D., Shea T.P., Benito M.-I., Town C.D.,
Fujii C.Y., Mason T.M., Bowman C.L., Barnstead M.E., Feldblyum T.V.,
Buell C.R., Ketchum K.A., Lee J.J., Ronning C.M., Koo H.L.,
Moffat K.S., Cronin L.A., Shen M., Pai G., Van Aken S., Umayam L.,
Tallon L.J., Gill J.E., Adams M.D., Carrera A.J., Creasy T.H.,
Goodman H.M., Somerville C.R., Copenhaver G.P., Preuss D.,
Nierman W.C., White O., Eisen J.A., Salzberg S.L., Fraser C.M.,
Venter J.C.;
"Sequence and analysis of chromosome 2 of the plant Arabidopsis
thaliana.";
Nature 402:761-768(1999).
[2]
GENOME REANNOTATION.
STRAIN=cv. Columbia;
PubMed=27862469; DOI=10.1111/tpj.13415;
Cheng C.Y., Krishnakumar V., Chan A.P., Thibaud-Nissen F., Schobel S.,
Town C.D.;
"Araport11: a complete reannotation of the Arabidopsis thaliana
reference genome.";
Plant J. 89:789-804(2017).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
STRAIN=cv. Columbia;
PubMed=14593172; DOI=10.1126/science.1088305;
Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J.,
Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F.,
Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.,
Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J.,
Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y.,
Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P.,
Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F.,
Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M.,
Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J.,
Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T.,
Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y.,
Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
"Empirical analysis of transcriptional activity in the Arabidopsis
genome.";
Science 302:842-846(2003).
[4]
GENE FAMILY.
PubMed=12649433; DOI=10.1110/ps.0237503;
Schleiff E., Eichacker L.A., Eckart K., Becker T., Mirus O., Stahl T.,
Soll J.;
"Prediction of the plant beta-barrel proteome: a case study of the
chloroplast outer envelope.";
Protein Sci. 12:748-759(2003).
[5]
FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, AND SUBCELLULAR
LOCATION.
STRAIN=cv. Columbia;
PubMed=16624824; DOI=10.1074/jbc.M600700200;
Goetze T.A., Philippar K., Ilkavets I., Soll J., Wagner R.;
"OEP37 is a new member of the chloroplast outer membrane ion
channels.";
J. Biol. Chem. 281:17989-17998(2006).
-!- FUNCTION: Voltage-dependent peptide-sensitive high conductance
rectifying cation channel with a strong affinity for TIC32 that is
imported into the chloroplast. Conductance is pH-dependent
decreasing with decreasing pH values.
{ECO:0000269|PubMed:16624824}.
-!- SUBUNIT: Forms a hourglass-shaped multimeric complex.
{ECO:0000250}.
-!- SUBCELLULAR LOCATION: Plastid, chloroplast outer membrane
{ECO:0000269|PubMed:16624824}; Multi-pass membrane protein
{ECO:0000269|PubMed:16624824}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=O80565-1; Sequence=Displayed;
Name=2;
IsoId=O80565-2; Sequence=VSP_042323;
Note=Derived from EST data. No experimental confirmation
available.;
-!- TISSUE SPECIFICITY: Ubiquitously expressed at low levels. Mostly
present in cotyledons, and accumulates in seedlings and embryos.
{ECO:0000269|PubMed:16624824}.
-!- DEVELOPMENTAL STAGE: During seed development, confined to green
cotyledons of mature embryos. In germinating seedlings, detected
in cotyledons and the root hair zone of the primary root. In older
seedlings, restricted to cotyledons.
{ECO:0000269|PubMed:16624824}.
-!- SIMILARITY: Belongs to the plastid outer envelope porin OEP37 (TC
1.B.47) family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AC004005; AAC23403.2; -; Genomic_DNA.
EMBL; CP002685; AEC10352.1; -; Genomic_DNA.
EMBL; CP002685; AEC10354.1; -; Genomic_DNA.
EMBL; AY045937; AAK76611.1; -; mRNA.
EMBL; AY079409; AAL85140.1; -; mRNA.
PIR; T00675; T00675.
RefSeq; NP_566003.1; NM_129957.4. [O80565-1]
RefSeq; NP_850405.2; NM_180074.3. [O80565-2]
UniGene; At.19493; -.
ProteinModelPortal; O80565; -.
BioGrid; 4336; 1.
IntAct; O80565; 2.
STRING; 3702.AT2G43950.1; -.
TCDB; 1.B.47.1.2; the plastid outer envelope porin of 37 kda (oep37) family.
SwissPalm; O80565; -.
PaxDb; O80565; -.
EnsemblPlants; AT2G43950.1; AT2G43950.1; AT2G43950. [O80565-1]
EnsemblPlants; AT2G43950.2; AT2G43950.2; AT2G43950. [O80565-2]
GeneID; 819000; -.
Gramene; AT2G43950.1; AT2G43950.1; AT2G43950. [O80565-1]
Gramene; AT2G43950.2; AT2G43950.2; AT2G43950. [O80565-2]
KEGG; ath:AT2G43950; -.
Araport; AT2G43950; -.
TAIR; locus:2051844; AT2G43950.
eggNOG; ENOG410IJ87; Eukaryota.
eggNOG; ENOG410ZZSD; LUCA.
HOGENOM; HOG000239249; -.
InParanoid; O80565; -.
OMA; VGWASLW; -.
OrthoDB; EOG09360NCP; -.
PhylomeDB; O80565; -.
PRO; PR:O80565; -.
Proteomes; UP000006548; Chromosome 2.
ExpressionAtlas; O80565; baseline and differential.
Genevisible; O80565; AT.
GO; GO:0009507; C:chloroplast; IDA:TAIR.
GO; GO:0009941; C:chloroplast envelope; IDA:TAIR.
GO; GO:0009706; C:chloroplast inner membrane; IDA:TAIR.
GO; GO:0031359; C:integral component of chloroplast outer membrane; IDA:UniProtKB.
GO; GO:0016020; C:membrane; IDA:TAIR.
GO; GO:0005739; C:mitochondrion; IDA:TAIR.
GO; GO:0009536; C:plastid; IDA:TAIR.
GO; GO:0046930; C:pore complex; IEA:UniProtKB-KW.
GO; GO:0042802; F:identical protein binding; ISS:UniProtKB.
GO; GO:0005216; F:ion channel activity; IDA:TAIR.
GO; GO:0015288; F:porin activity; IEA:UniProtKB-KW.
GO; GO:0006812; P:cation transport; IDA:TAIR.
InterPro; IPR038951; OEP37-like.
PANTHER; PTHR35484; PTHR35484; 1.
2: Evidence at transcript level;
Alternative splicing; Chloroplast; Complete proteome; Ion transport;
Membrane; Plastid; Plastid outer membrane; Porin; Reference proteome;
Transit peptide; Transmembrane; Transmembrane beta strand; Transport.
TRANSIT 1 73 Chloroplast. {ECO:0000255}.
CHAIN 74 343 Outer envelope pore protein 37,
chloroplastic.
/FTId=PRO_0000415711.
TOPO_DOM 74 76 Cytoplasmic.
TRANSMEM 77 86 Beta stranded; Name=1. {ECO:0000255}.
TOPO_DOM 87 103 Chloroplast intermembrane.
TRANSMEM 104 113 Beta stranded; Name=2. {ECO:0000255}.
TOPO_DOM 114 129 Cytoplasmic.
TRANSMEM 130 137 Beta stranded; Name=3. {ECO:0000255}.
TOPO_DOM 138 154 Chloroplast intermembrane.
TRANSMEM 155 164 Beta stranded; Name=4. {ECO:0000255}.
TOPO_DOM 165 169 Cytoplasmic.
TRANSMEM 170 178 Beta stranded; Name=5. {ECO:0000255}.
TOPO_DOM 179 219 Chloroplast intermembrane.
TRANSMEM 220 228 Beta stranded; Name=6. {ECO:0000255}.
TOPO_DOM 229 230 Cytoplasmic.
TRANSMEM 231 240 Beta stranded; Name=7. {ECO:0000255}.
TOPO_DOM 241 241 Chloroplast intermembrane.
TRANSMEM 242 250 Beta stranded; Name=8. {ECO:0000255}.
TOPO_DOM 251 257 Cytoplasmic.
TRANSMEM 258 267 Beta stranded; Name=9. {ECO:0000255}.
TOPO_DOM 268 269 Chloroplast intermembrane.
TRANSMEM 270 279 Beta stranded; Name=10. {ECO:0000255}.
TOPO_DOM 280 286 Cytoplasmic.
TRANSMEM 287 296 Beta stranded; Name=11. {ECO:0000255}.
TOPO_DOM 297 316 Chloroplast intermembrane.
TRANSMEM 317 326 Beta stranded; Name=12. {ECO:0000255}.
TOPO_DOM 327 343 Cytoplasmic.
VAR_SEQ 302 343 GDEAGKVKTTPMKMKVQFMLQVPQDDIKSSVLMFRVKKRWD
I -> NHQPLVFFSLFSHQRNLFTRLSPNPSHTSKML (in
isoform 2). {ECO:0000305}.
/FTId=VSP_042323.
SEQUENCE 343 AA; 38835 MW; FB26B8C037EF7169 CRC64;
MADPSSQNPN LATPPPPSSP SPTHQIQSGT SELSPPSRPP CSTLSFLKTA NRPKLRVTSE
FDSDSLLFLN KVSCKLFDNL AKLKLSFQNN SQREISQPQV SFTSKHVSVL YDVEEKNTFI
KSTLDVHPRL QLRALHNVKA QQGEVAMEAN LTEPGYSLEL SSPVPIGYPR ATLKFPLGEI
SLQEKDEEEE EKQKRTLSVN GILKRQVMNG VCTALYTDEE LRLRYAYKDD ALSFIPSISL
PSNAASFAFK RRFSPSDKLS YWYNFDSNMW SAVYKRTYGK DYKLKAGYDS DVRLGWASLW
VGDEAGKVKT TPMKMKVQFM LQVPQDDIKS SVLMFRVKKR WDI


Related products :

Catalog number Product name Quantity
EIAAB29436 Homo sapiens,Human,KIAA0618,Nuclear envelope pore membrane protein POM 121,Nuclear envelope pore membrane protein POM 121A,Nucleoporin Nup121,NUP121,POM121,POM121A,Pore membrane protein of 121 kDa
EIAAB31732 Homo sapiens,Human,KIAA0906,Nuclear envelope pore membrane protein POM 210,Nuclear pore membrane glycoprotein 210,Nuclear pore protein gp210,Nucleoporin Nup210,NUP210,POM210,Pore membrane protein of 2
EIAAB31733 Kiaa0906,Mouse,Mus musculus,Nuclear envelope pore membrane protein POM 210,Nuclear pore membrane glycoprotein 210,Nuclear pore protein gp210,Nucleoporin Nup210,Nup210,POM210,Pore membrane protein of 2
EIAAB29438 Homo sapiens,Human,Nuclear envelope pore membrane protein POM 121C,Nuclear pore membrane protein 121-2,POM121-2,POM121C,Pore membrane protein of 121 kDa C
EIAAB31734 Gp210,Nuclear envelope pore membrane protein POM 210,Nuclear pore membrane glycoprotein 210,Nuclear pore protein gp210,Nucleoporin Nup210,POM210,Pom210,Pore membrane protein of 210 kDa,Rat,Rattus norv
EIAAB31730 Nuclear envelope pore membrane protein POM 121,Nucleoporin Nup121,Nup121,p145,Pom121,Pore membrane protein of 121 kDa,Rat,Rattus norvegicus
EIAAB31731 Mouse,Mus musculus,Nuclear envelope pore membrane protein POM 121,Nucleoporin Nup121,Nup121,Pom121,Pore membrane protein of 121 kDa
AS07235 Toc34 | chloroplast outer envelope membrane translocon complex protein 50 ul
AS07236 Toc33 | chloroplast outer envelope membrane translocon complex protein 50 ul
AS07237 Toc34 | chloroplast outer envelope membrane translocon complex protein 50 ul
AS07238 Toc34 | chloroplast outer envelope membrane translocon complex protein 50 ul
AS07 235 Toc34 | chloroplast outer envelope membrane translocon complex protein 50 ul
AS07 236 Toc33 | chloroplast outer envelope membrane translocon complex protein 50 ul
AS07 237 Toc34 | chloroplast outer envelope membrane translocon complex protein 50 ul
AS07239 Toc159 | chloroplast outer envelope membrane translocon complex protein 50 ul
AS07 238 Toc34 | chloroplast outer envelope membrane translocon complex protein 50 ul
AS07 239 Toc159 | chloroplast outer envelope membrane translocon complex protein 50 ul
AS07 235 hen polyclonal Toc34 | chloroplast outer envelope membrane translocon complex protein 50
AS06150 Toc75 | chloroplast outer envelope mebrane translocon complex OEP75 protein 200 ul
AS07 237 hen polyclonal Toc34 | chloroplast outer envelope membrane translocon complex protein 50
AS06 150 Toc75 | chloroplast outer envelope mebrane translocon complex OEP75 protein 200 ul
AS07 236 hen polyclonal Toc33 | chloroplast outer envelope membrane translocon complex protein 50
AS07 238 rabbit polyclonal Toc34 | chloroplast outer envelope membrane translocon complex protein 50
AS07 239 guinea pig polyclonal Toc159 | chloroplast outer envelope membrane translocon complex protein 50
AS06 150 rabbit polyclonal Toc75 | chloroplast outer envelope membrane translocon complex OEP75 protein 200


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur