Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

PKHD-type hydroxylase PST_0995 (EC 1.14.11.-)

 Y995_PSEU5              Reviewed;         226 AA.
05-FEB-2008, integrated into UniProtKB/Swiss-Prot.
29-MAY-2007, sequence version 1.
10-OCT-2018, entry version 67.
RecName: Full=PKHD-type hydroxylase PST_0995 {ECO:0000255|HAMAP-Rule:MF_00657};
EC=1.14.11.- {ECO:0000255|HAMAP-Rule:MF_00657};
Pseudomonas stutzeri (strain A1501).
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
Pseudomonadaceae; Pseudomonas.
PubMed=18495935; DOI=10.1073/pnas.0801093105;
Yan Y., Yang J., Dou Y., Chen M., Ping S., Peng J., Lu W., Zhang W.,
Yao Z., Li H., Liu W., He S., Geng L., Zhang X., Yang F., Yu H.,
Zhan Y., Li D., Lin Z., Wang Y., Elmerich C., Lin M., Jin Q.;
"Nitrogen fixation island and rhizosphere competence traits in the
genome of root-associated Pseudomonas stutzeri A1501.";
Proc. Natl. Acad. Sci. U.S.A. 105:7564-7569(2008).
Name=Fe(2+); Xref=ChEBI:CHEBI:29033;
Note=Binds 1 Fe(2+) ion per subunit. {ECO:0000255|HAMAP-
Name=L-ascorbate; Xref=ChEBI:CHEBI:38290;
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
EMBL; CP000304; ABP78692.1; -; Genomic_DNA.
RefSeq; WP_011912183.1; NC_009434.1.
ProteinModelPortal; A4VI91; -.
SMR; A4VI91; -.
STRING; 379731.PST_0995; -.
EnsemblBacteria; ABP78692; ABP78692; PST_0995.
KEGG; psa:PST_0995; -.
eggNOG; ENOG4107E2E; Bacteria.
eggNOG; COG3128; LUCA.
HOGENOM; HOG000236239; -.
KO; K07336; -.
OrthoDB; POG091H0LGZ; -.
Proteomes; UP000000233; Chromosome.
GO; GO:0005506; F:iron ion binding; IEA:UniProtKB-UniRule.
GO; GO:0031418; F:L-ascorbic acid binding; IEA:UniProtKB-KW.
GO; GO:0016706; F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors; IEA:UniProtKB-UniRule.
HAMAP; MF_00657; Hydroxyl_YbiX; 1.
InterPro; IPR005123; Oxoglu/Fe-dep_dioxygenase.
InterPro; IPR023550; PKHD_hydroxylase.
InterPro; IPR006620; Pro_4_hyd_alph.
PANTHER; PTHR41536; PTHR41536; 1.
Pfam; PF13640; 2OG-FeII_Oxy_3; 1.
SMART; SM00702; P4Hc; 1.
3: Inferred from homology;
Complete proteome; Dioxygenase; Iron; Metal-binding; Oxidoreductase;
Reference proteome; Vitamin C.
CHAIN 1 226 PKHD-type hydroxylase PST_0995.
DOMAIN 78 178 Fe2OG dioxygenase. {ECO:0000255|HAMAP-
METAL 96 96 Iron. {ECO:0000255|HAMAP-Rule:MF_00657}.
METAL 98 98 Iron. {ECO:0000255|HAMAP-Rule:MF_00657}.
METAL 159 159 Iron. {ECO:0000255|HAMAP-Rule:MF_00657}.
BINDING 169 169 2-oxoglutarate. {ECO:0000255|HAMAP-
SEQUENCE 226 AA; 25642 MW; 37399EECCA440C40 CRC64;

Related products :

Catalog number Product name Quantity
CQ101_HUMAN Human ELISA Kit FOR PKHD domain-containing transmembrane protein C17orf101 96T
EIAAB08039 Cmah,CMP-N-acetylneuraminate monooxygenase,CMP-N-acetylneuraminic acid hydroxylase,CMP-Neu5Ac hydroxylase,CMP-NeuAc hydroxylase,Cytidine monophosphate-N-acetylneuraminic acid hydroxylase,Mouse,Mus mus
AM05146PU-N Tryptophan Hydroxylase (TRH), Tyrosine Hydroxylase (TYH), Phenylalanine Hydroxylase (PAH) Clone PH8 antibody Isotype IgG Host Mouse 0.5 mg
MD-14-0594 Mouse Anti-Tryptophan Hydroxylase, Tyrosine Hydroxylase and Phenylalanine Hydroxylase 500
RB-PP-0995 MF C208H343N65O48 ; MW 4522.38; LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS, Leu-Leu-Gly-Asn-Phe-Phe-Arg-Lys-Ser-Lys-Gln-Lys-Ile-Gly-Lys-Gln-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asn-Phe-Phe-Arg-Asn-Leu-Val 1 mg
MA1100 Monoclonal Anti-Tyrosine Hydroxylase, Clone number: TH-100, Ig type: mouse IgG1, Immunogen: Rat tyrosine hydroxylase(TH)., Specificity: Human;rat;rabbit. No cross reactivity with other proteins. 100μg/vial
201-20-0995 CDK9{cyclin-dependent kinase 9}rabbit.pAb 0.1ml
201-11-0995 Rat Heat Shock Protein 47(HSP47)ELISA kit 96T
201-11-0995 Rat Heat Shock Protein 47 (HSP47)ELISA kit 96T
AM05146PU-N Tryptophan Hydroxylase (TRH), Tyrosine Hydroxylase (TYH), Phenylalanine Hydroxylase (PAH) 0.5 mg
AM05146PU-N Tryptophan Hydroxylase (TRH), Tyrosine Hydroxylase (TYH), Phenylalanine Hydroxylase (PAH) 0.5 mg
ER-14-0995 Goat Anti-ORP2, with HRP-conjugated secondary antibody 100
ER-14-0995 Goat Anti-Human ORP2, (C Terminus) Antibodies 100 μg
201-12-0995 Human Immunoreactive growth hormone,irGH ELISA Kit 96T
201-12-0995 Human Immunoreactive growth hormone(irGH)ELISA Kit 96T
201-12-0995 Human Immunoreactive growth hormone,irGH ELISA Kit 48T
201-02-0995 Mouse Epidermal growth factor receptor 2(HER2)ELISA Kit 96T
MA1099 Monoclonal Anti-Tryptophan Hydroxylase, Clone number: Try-63, Ig type: mouse IgG3, Immunogen: Recombinant rabbit tryptophan hydroxylase., Specificity: Human;rat;rabbit. No cross reactivity with other 100μg/vial
CSB-EL003323HU Human PKHD domain-containing transmembrane protein C17orf101(C17orf101) ELISA kit 96T
CSB-EL003323HU Human PKHD domain-containing transmembrane protein C17orf101(C17orf101) ELISA kit SpeciesHuman 96T
EIAAB09201 C17orf101,Homo sapiens,Human,PKHD domain-containing transmembrane protein C17orf101
EIAAB12620 Egl nine homolog 3,EGLN3,HIF-PH3,HIF-prolyl hydroxylase 3,Homo sapiens,HPH-1,HPH-3,Human,Hypoxia-inducible factor prolyl hydroxylase 3,PHD3,Prolyl hydroxylase domain-containing protein 3
18-003-42538 Egl nine homolog 2 - EC 1.14.11.-; Hypoxia-inducible factor prolyl hydroxylase 1; HIF-prolyl hydroxylase 1; HIF-PH1; HPH-3; Prolyl hydroxylase domain-containing protein 1; PHD1; Estrogen-induced tag 6 0.05 mg Aff Pur
EIAAB12617 Egl nine homolog 2,EGLN2,EIT6,Estrogen-induced tag 6,HIF-PH1,HIF-prolyl hydroxylase 1,Homo sapiens,HPH-1,HPH-3,Human,Hypoxia-inducible factor prolyl hydroxylase 1,PHD1,Prolyl hydroxylase domain-contai
18-003-42563 Egl nine homolog 1 - EC 1.14.11.-; Hypoxia-inducible factor prolyl hydroxylase 2; HIF-prolyl hydroxylase 2; HIF-PH2; HPH-2; Prolyl hydroxylase domain-containing protein 2; PHD2; SM-20 Polyclonal 0.1 mg Protein A


GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur

Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur



9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017


france@gentaur.com | Gentaur

Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123

GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U

spain@gentaur.com | Gentaur

ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636

GENTAUR Poland Sp. z o.o.

ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556


Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur