Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Paired mesoderm homeobox protein 1 (Homeobox protein K-2) (Homeobox protein mHox) (Paired-related homeobox protein 1) (PRX-1)

 PRRX1_MOUSE             Reviewed;         245 AA.
P63013; P43271; Q02810; Q569N6;
31-AUG-2004, integrated into UniProtKB/Swiss-Prot.
31-AUG-2004, sequence version 1.
12-SEP-2018, entry version 123.
RecName: Full=Paired mesoderm homeobox protein 1;
AltName: Full=Homeobox protein K-2;
AltName: Full=Homeobox protein mHox;
AltName: Full=Paired-related homeobox protein 1;
Short=PRX-1;
Name=Prrx1; Synonyms=Pmx, Pmx1;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
PubMed=1360403;
Cserjesi P., Lilly B., Bryson L., Wang Y., Sassoon D.A., Olson E.N.;
"MHox: a mesodermally restricted homeodomain protein that binds an
essential site in the muscle creatine kinase enhancer.";
Development 115:1087-1101(1992).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
PubMed=7910581; DOI=10.1006/geno.1994.1066;
Kern M.J., Argao E.A., Birkenmeier E.H., Rowe L.B., Potter S.S.;
"Genomic organization and chromosome localization of the murine
homeobox gene Pmx.";
Genomics 19:334-340(1994).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
STRAIN=CD-1;
PubMed=1383943; DOI=10.1093/nar/20.19.5189;
Kern M.J., Witte D.P., Valerius M.T., Aronow B.J., Potter S.S.;
"A novel murine homeobox gene isolated by a tissue specific PCR
cloning strategy.";
Nucleic Acids Res. 20:5189-5195(1992).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
STRAIN=C57BL/6J; TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5]
ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-160, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Embryonic fibroblast;
PubMed=23806337; DOI=10.1016/j.molcel.2013.06.001;
Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z.,
Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.;
"SIRT5-mediated lysine desuccinylation impacts diverse metabolic
pathways.";
Mol. Cell 50:919-930(2013).
-!- FUNCTION: Acts as a transcriptional regulator of muscle creatine
kinase (MCK) and so has a role in the establishment of diverse
mesodermal muscle types. The protein binds to an A/T-rich element
in the muscle creatine enhancer.
-!- SUBCELLULAR LOCATION: Nucleus.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1; Synonyms=K2-a, PMX1-B, Prx1a;
IsoId=P63013-1, P43271-1;
Sequence=Displayed;
Name=2; Synonyms=K2-b, PMX1-A, Prx1b;
IsoId=P63013-2, P43271-2;
Sequence=VSP_002279;
-!- TISSUE SPECIFICITY: Expressed exclusively in mesodermally derived
cell types. During embryogenesis, highest levels of expression are
found in the mesenchyme and precartilage elements of the face and
hind limbs. In the adult, expression is restricted to skeletal
muscle, heart and uterus.
-!- DEVELOPMENTAL STAGE: Expressed during cardiogenesis.
-!- SIMILARITY: Belongs to the paired homeobox family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; L06502; AAA39672.1; -; mRNA.
EMBL; U03873; AAC52139.1; -; mRNA.
EMBL; X59725; CAA42410.1; -; mRNA.
EMBL; BC092372; AAH92372.1; -; mRNA.
CCDS; CCDS15427.1; -.
CCDS; CCDS15428.1; -. [P63013-2]
PIR; I48902; I48902.
PIR; S26076; S26076.
RefSeq; NP_035257.1; NM_011127.2. [P63013-1]
RefSeq; NP_783617.2; NM_175686.3. [P63013-2]
RefSeq; XP_006496766.1; XM_006496703.3. [P63013-2]
UniGene; Mm.288642; -.
ProteinModelPortal; P63013; -.
SMR; P63013; -.
BioGrid; 202269; 2.
IntAct; P63013; 1.
STRING; 10090.ENSMUSP00000027878; -.
iPTMnet; P63013; -.
PhosphoSitePlus; P63013; -.
MaxQB; P63013; -.
PaxDb; P63013; -.
PRIDE; P63013; -.
Ensembl; ENSMUST00000027878; ENSMUSP00000027878; ENSMUSG00000026586. [P63013-1]
Ensembl; ENSMUST00000075805; ENSMUSP00000075203; ENSMUSG00000026586. [P63013-2]
GeneID; 18933; -.
KEGG; mmu:18933; -.
UCSC; uc007dhh.1; mouse. [P63013-2]
UCSC; uc007dhi.1; mouse.
CTD; 5396; -.
MGI; MGI:97712; Prrx1.
eggNOG; KOG0490; Eukaryota.
eggNOG; ENOG410YIJ3; LUCA.
GeneTree; ENSGT00920000148948; -.
HOGENOM; HOG000231518; -.
HOVERGEN; HBG021349; -.
InParanoid; P63013; -.
KO; K09329; -.
OMA; MATYPPT; -.
OrthoDB; EOG091G0B1L; -.
PhylomeDB; P63013; -.
TreeFam; TF351612; -.
PRO; PR:P63013; -.
Proteomes; UP000000589; Chromosome 1.
Bgee; ENSMUSG00000026586; Expressed in 363 organ(s), highest expression level in secondary palatal shelf.
CleanEx; MM_PRRX1; -.
ExpressionAtlas; P63013; baseline and differential.
Genevisible; P63013; MM.
GO; GO:0005829; C:cytosol; ISO:MGI.
GO; GO:0005654; C:nucleoplasm; ISO:MGI.
GO; GO:0005634; C:nucleus; IDA:MGI.
GO; GO:0003677; F:DNA binding; IDA:MGI.
GO; GO:0071837; F:HMG box domain binding; IPI:UniProtKB.
GO; GO:0000978; F:RNA polymerase II proximal promoter sequence-specific DNA binding; IDA:NTNU_SB.
GO; GO:0003713; F:transcription coactivator activity; IDA:MGI.
GO; GO:0001078; F:transcriptional repressor activity, RNA polymerase II proximal promoter sequence-specific DNA binding; IDA:NTNU_SB.
GO; GO:0048844; P:artery morphogenesis; IMP:MGI.
GO; GO:0051216; P:cartilage development; IMP:MGI.
GO; GO:0048701; P:embryonic cranial skeleton morphogenesis; IMP:MGI.
GO; GO:0030326; P:embryonic limb morphogenesis; IGI:MGI.
GO; GO:0048704; P:embryonic skeletal system morphogenesis; IMP:MGI.
GO; GO:0042472; P:inner ear morphogenesis; IGI:MGI.
GO; GO:0042474; P:middle ear morphogenesis; IMP:MGI.
GO; GO:0000122; P:negative regulation of transcription by RNA polymerase II; IDA:NTNU_SB.
GO; GO:0048664; P:neuron fate determination; IDA:MGI.
GO; GO:0097150; P:neuronal stem cell population maintenance; IDA:MGI.
GO; GO:0002053; P:positive regulation of mesenchymal cell proliferation; IGI:MGI.
GO; GO:0045880; P:positive regulation of smoothened signaling pathway; IGI:MGI.
GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; IDA:MGI.
GO; GO:0070570; P:regulation of neuron projection regeneration; IMP:MGI.
GO; GO:0060021; P:roof of mouth development; IMP:MGI.
CDD; cd00086; homeodomain; 1.
InterPro; IPR009057; Homeobox-like_sf.
InterPro; IPR017970; Homeobox_CS.
InterPro; IPR001356; Homeobox_dom.
InterPro; IPR003654; OAR_dom.
Pfam; PF00046; Homeobox; 1.
Pfam; PF03826; OAR; 1.
SMART; SM00389; HOX; 1.
SUPFAM; SSF46689; SSF46689; 1.
PROSITE; PS00027; HOMEOBOX_1; 1.
PROSITE; PS50071; HOMEOBOX_2; 1.
PROSITE; PS50803; OAR; 1.
1: Evidence at protein level;
Acetylation; Alternative splicing; Complete proteome;
Developmental protein; DNA-binding; Homeobox; Nucleus; Phosphoprotein;
Reference proteome.
CHAIN 1 245 Paired mesoderm homeobox protein 1.
/FTId=PRO_0000049252.
DNA_BIND 94 153 Homeobox. {ECO:0000255|PROSITE-
ProRule:PRU00108}.
MOTIF 222 235 OAR. {ECO:0000255|PROSITE-
ProRule:PRU00138}.
MOD_RES 21 21 Phosphoserine.
{ECO:0000250|UniProtKB:P63014}.
MOD_RES 160 160 N6-acetyllysine.
{ECO:0000244|PubMed:23806337}.
MOD_RES 197 197 Phosphoserine. {ECO:0000255}.
VAR_SEQ 200 245 SAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQ
VPTVN -> RSSSLPRCCLHEGLHNGF (in isoform
2). {ECO:0000303|PubMed:1360403,
ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:7910581}.
/FTId=VSP_002279.
SEQUENCE 245 AA; 27269 MW; FF867F0D856E1115 CRC64;
MTSSYGHVLE RQPALGGRLD SPGNLDTLQA KKNFSVSHLL DLEEAGDMVA AQADESVGEA
GRSLLESPGL TSGSDTPQQD NDQLNSEEKK KRKQRRNRTT FNSSQLQALE RVFERTHYPD
AFVREDLARR VNLTEARVQV WFQNRRAKFR RNERAMLANK NASLLKSYSG DVTAVEQPIV
PRPAPRPTDY LSWGTASPYS AMATYSATCA NNSPAQGINM ANSIANLRLK AKEYSLQRNQ
VPTVN


Related products :

Catalog number Product name Quantity
EIAAB32588 Homeobox protein K-2,Homeobox protein mHox,Mouse,Mus musculus,Paired mesoderm homeobox protein 1,Paired-related homeobox protein 1,Pmx,Pmx1,Prrx1,PRX-1
EIAAB32586 Chicken,Gallus gallus,GMHOX,Homeobox protein MHOX,MHOX,Paired mesoderm homeobox protein 1,Paired-related homeobox protein 1,PMX1,PRRX1,PRX1,PRX-1
EIAAB32587 Homeobox protein PHOX1,Homo sapiens,Human,Paired mesoderm homeobox protein 1,Paired-related homeobox protein 1,PMX1,PRRX1,PRX-1
EIAAB30960 Aristaless homeobox protein homolog,ARIX,ARIX1 homeodomain protein,Homo sapiens,Human,Paired mesoderm homeobox protein 2A,Paired-like homeobox 2A,PHOX2A,PMX2A
EIAAB30959 Aristaless homeobox protein homolog,Arix,ARIX1 homeodomain protein,Paired mesoderm homeobox protein 2A,Paired-like homeobox 2A,Phox2a,Pmx2a,Rat,Rattus norvegicus
EIAAB30961 Aristaless homeobox protein homolog,Arix,Mouse,Mus musculus,Paired mesoderm homeobox protein 2A,Paired-like homeobox 2A,Phox2,Phox2a,PHOX2A homeodomain protein,Pmx2,Pmx2a
EIAAB32591 Homo sapiens,Human,Paired mesoderm homeobox protein 2,Paired-related homeobox protein 2,PMX2,PRRX2,PRX2,PRX-2
EIAAB32585 Paired mesoderm homeobox protein 1,Paired-related homeobox protein 1,Prrx1,PRX-1,Rat,Rattus norvegicus,rHox
18-003-43167 Diencephalon_mesencephalon homeobox protein 1 - Diencephalon_mesencephalon-expressed brain homeobox gene 1 protein; Paired-like homeobox protein DMBX1; Paired-type homeobox Atx; Orthodenticle homolog 0.05 mg Aff Pur
18-003-42353 Short stature homeobox protein 2 - Paired-related homeobox protein SHOT; Homeobox protein Og12X Polyclonal 0.05 mg Aff Pur
18-003-42354 Short stature homeobox protein 2 - Paired-related homeobox protein SHOT; Homeobox protein Og12X Polyclonal 0.1 mg Protein A
18-003-42354 Short stature homeobox protein 2 - Paired-related homeobox protein SHOT; Homeobox protein Og12X Polyclonal 0.05 mg Aff Pur
18-003-42353 Short stature homeobox protein 2 - Paired-related homeobox protein SHOT; Homeobox protein Og12X Polyclonal 0.1 mg Protein A
EIAAB30963 Homo sapiens,Human,NBPhox,Neuroblastoma Phox,Paired mesoderm homeobox protein 2B,Paired-like homeobox 2B,PHOX2B,PHOX2B homeodomain protein,PMX2B
EIAAB30962 Mouse,Mus musculus,NBPhox,Neuroblastoma Phox,Paired mesoderm homeobox protein 2B,Paired-like homeobox 2B,Phox2b,PHOX2B homeodomain protein,Pmx2b
EIAAB31191 Bft,Hindlimb-expressed homeobox protein backfoot,Homeobox protein PITX1,Homeobox protein P-OTX,Mouse,Mus musculus,Paired-like homeodomain transcription factor 1,Pituitary homeobox 1,Pituitary OTX-rela
EIAAB32589 Homeobox protein S8,Mouse,Mus musculus,Paired mesoderm homeobox protein 2,Prrx2,Prx2,PRX-2,S8
EIAAB38316 Homeobox protein Og12X,Homo sapiens,Human,OG12X,Paired-related homeobox protein SHOT,Short stature homeobox protein 2,SHOT,SHOX2
EIAAB11927 Dorsal root ganglia homeobox protein,DRGX,Homo sapiens,Human,Paired-related homeobox protein-like 1,PRRXL1
EIAAB11459 Cdmx,Diencephalon_mesencephalon homeobox protein 1,Diencephalon_mesencephalon-expressed brain homeobox gene 1 protein,Dmbx1,Mbx,Mouse,Mus musculus,Orthodenticle homolog 3,Otx3,Paired-like homeobox pro
EIAAB34785 Homo sapiens,Human,Paired-like homeobox protein PEPP-2,PEPP2,Rhox homeobox family member 2,RHOXF2,Testis homeobox gene 1,THG1
EIAAB31193 BFT,Hindlimb-expressed homeobox protein backfoot,Homeobox protein PITX1,Homo sapiens,Human,Paired-like homeodomain transcription factor 1,Pituitary homeobox 1,PITX1,PTX1
EIAAB11928 Dorsal root ganglia homeobox protein,Dorsal root ganglion 11,Drg11,Drgx,Homeobox protein DRG11,Mouse,Mus musculus,Paired-related homeobox protein-like 1,Prrxl1
EIAAB11926 Dorsal root ganglia homeobox protein,Dorsal root ganglion 11,Drg11,Drgx,Homeobox protein DRG11,Paired-related homeobox protein-like 1,Prrxl1,Rat,Rattus norvegicus
EIAAB31197 ALL1-responsive protein ARP1,ARP1,Homeobox protein PITX2,Homo sapiens,Human,Paired-like homeodomain transcription factor 2,Pituitary homeobox 2,PITX2,RGS,RIEG,RIEG bicoid-related homeobox transcriptio


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur