Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Phosphatidylinositol 4-phosphate 5-kinase type-1 beta (PIP5K1-beta) (PtdIns(4)P-5-kinase 1 beta) (EC 2.7.1.68) (Phosphatidylinositol 4-phosphate 5-kinase type I beta) (PIP5KIbeta) (Protein STM-7) (Type I phosphatidylinositol 4-phosphate 5-kinase beta)

 PI51B_HUMAN             Reviewed;         540 AA.
O14986; A8K9L9; B4DIG7; P78518; P78519; Q5T5K6; Q5T5K8; Q5T5K9;
Q5VZ00; Q7KYT5; Q8NHQ5; Q92749;
25-OCT-2005, integrated into UniProtKB/Swiss-Prot.
25-OCT-2005, sequence version 2.
18-JUL-2018, entry version 137.
RecName: Full=Phosphatidylinositol 4-phosphate 5-kinase type-1 beta;
Short=PIP5K1-beta;
Short=PtdIns(4)P-5-kinase 1 beta;
EC=2.7.1.68;
AltName: Full=Phosphatidylinositol 4-phosphate 5-kinase type I beta;
Short=PIP5KIbeta;
AltName: Full=Protein STM-7;
AltName: Full=Type I phosphatidylinositol 4-phosphate 5-kinase beta;
Name=PIP5K1B; Synonyms=STM7;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=8841185; DOI=10.1038/ng1096-157;
Carvajal J.J., Pook M.A., dos Santos M., Doudney K., Hillermann R.,
Minogue S., Williamson R., Hsuan J.J., Chamberlain S.;
"The Friedreich's ataxia gene encodes a novel phosphatidylinositol-4-
phosphate 5-kinase.";
Nat. Genet. 14:157-162(1996).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-415, AND ALTERNATIVE
SPLICING.
PubMed=9177790; DOI=10.1006/geno.1997.4726;
Pook M.A., Carvajal J.J., Doudney K., Hillermann R., Chamberlain S.;
"Exon-intron structure of a 2.7-kb transcript of the STM7 gene with
phosphatidylinositol-4-phosphate 5-kinase activity.";
Genomics 42:170-172(1997).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
TISSUE=Kidney;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15164053; DOI=10.1038/nature02465;
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E.,
Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C.,
Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S.,
Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R.,
Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P.,
Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W.,
Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G.,
Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M.,
Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W.,
Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A.,
Frankland J.A., French L., Fricker D.G., Garner P., Garnett J.,
Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S.,
Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E.,
Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D.,
Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E.,
Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K.,
Kimberley A.M., King A., Knights A., Laird G.K., Langford C.,
Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M.,
Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S.,
McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J.,
Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R.,
Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M.,
Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M.,
Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A.,
Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P.,
Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W.,
Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M.,
Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S.,
Rogers J., Dunham I.;
"DNA sequence and analysis of human chromosome 9.";
Nature 429:369-374(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Testis;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
NUCLEOTIDE SEQUENCE [MRNA] OF 340-540 (ISOFORM 1), AND TISSUE
SPECIFICITY.
TISSUE=Fetal brain;
PubMed=8955136; DOI=10.1074/jbc.271.51.32937;
Loijens J.C., Anderson R.A.;
"Type I phosphatidylinositol-4-phosphate 5-kinases are distinct
members of this novel lipid kinase family.";
J. Biol. Chem. 271:32937-32943(1996).
[8]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19369195; DOI=10.1074/mcp.M800588-MCP200;
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,
Mann M., Daub H.;
"Large-scale proteomics analysis of the human kinome.";
Mol. Cell. Proteomics 8:1751-1764(2009).
[9]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
-!- FUNCTION: Participates in the biosynthesis of phosphatidylinositol
4,5-bisphosphate. Mediates RAC1-dependent reorganization of actin
filaments. Contributes to the activation of PLD2. Together with
PIP5K1A is required after stimulation of G-protein coupled
receptors for stable platelet adhesion (By similarity).
{ECO:0000250}.
-!- CATALYTIC ACTIVITY: ATP + 1-phosphatidyl-1D-myo-inositol 4-
phosphate = ADP + 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate.
-!- SUBUNIT: Interacts with RAC1, AJUBA, PLD1, PLD2 and ARF1.
{ECO:0000250}.
-!- SUBCELLULAR LOCATION: Endomembrane system {ECO:0000250}.
Note=Associated with membranes. {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=O14986-1; Sequence=Displayed;
Name=2; Synonyms=Isoform 1;
IsoId=O14986-2; Sequence=VSP_016010, VSP_016011;
Name=3;
IsoId=O14986-3; Sequence=VSP_054771;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Detected in heart, pancreas, brain, kidney,
skeletal muscle and lung. {ECO:0000269|PubMed:8955136}.
-!- CAUTION: There is confusion in the literature with
phosphatidylinositol 4-phosphate 5-kinase type I nomenclature due
to the fact that frequently mouse PIP5K1B is named
Phosphatidylinositol 4-phosphate 5-kinase type I alpha.
{ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; X92493; CAA63224.1; -; mRNA.
EMBL; U52387; AAC51327.1; -; Genomic_DNA.
EMBL; U52376; AAC51327.1; JOINED; Genomic_DNA.
EMBL; U52377; AAC51327.1; JOINED; Genomic_DNA.
EMBL; U52378; AAC51327.1; JOINED; Genomic_DNA.
EMBL; U52379; AAC51327.1; JOINED; Genomic_DNA.
EMBL; U52380; AAC51327.1; JOINED; Genomic_DNA.
EMBL; U52381; AAC51327.1; JOINED; Genomic_DNA.
EMBL; U52382; AAC51327.1; JOINED; Genomic_DNA.
EMBL; U52383; AAC51327.1; JOINED; Genomic_DNA.
EMBL; U52384; AAC51327.1; JOINED; Genomic_DNA.
EMBL; U52385; AAC51327.1; JOINED; Genomic_DNA.
EMBL; U52386; AAC51327.1; JOINED; Genomic_DNA.
EMBL; AK292734; BAF85423.1; -; mRNA.
EMBL; AK295587; BAG58479.1; -; mRNA.
EMBL; AL162730; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL354794; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL356219; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471089; EAW62465.1; -; Genomic_DNA.
EMBL; BC030587; AAH30587.1; -; mRNA.
EMBL; U78580; AAC50915.1; -; mRNA.
CCDS; CCDS65063.1; -. [O14986-3]
CCDS; CCDS6624.1; -. [O14986-1]
RefSeq; NP_001265182.1; NM_001278253.1. [O14986-3]
RefSeq; NP_003549.1; NM_003558.3. [O14986-1]
RefSeq; XP_005252318.1; XM_005252261.3. [O14986-1]
RefSeq; XP_005252319.1; XM_005252262.4. [O14986-1]
RefSeq; XP_006717363.1; XM_006717300.2. [O14986-1]
RefSeq; XP_006717364.1; XM_006717301.1. [O14986-3]
RefSeq; XP_011517384.1; XM_011519082.2. [O14986-1]
RefSeq; XP_011517385.1; XM_011519083.2. [O14986-1]
RefSeq; XP_011517386.1; XM_011519084.2. [O14986-1]
RefSeq; XP_016870677.1; XM_017015188.1. [O14986-1]
RefSeq; XP_016870678.1; XM_017015189.1. [O14986-1]
RefSeq; XP_016870679.1; XM_017015190.1. [O14986-1]
RefSeq; XP_016870680.1; XM_017015191.1. [O14986-3]
UniGene; Hs.534371; -.
ProteinModelPortal; O14986; -.
SMR; O14986; -.
BioGrid; 113984; 2.
CORUM; O14986; -.
IntAct; O14986; 2.
STRING; 9606.ENSP00000265382; -.
iPTMnet; O14986; -.
PhosphoSitePlus; O14986; -.
SwissPalm; O14986; -.
EPD; O14986; -.
MaxQB; O14986; -.
PaxDb; O14986; -.
PeptideAtlas; O14986; -.
PRIDE; O14986; -.
ProteomicsDB; 48360; -.
ProteomicsDB; 48361; -. [O14986-2]
DNASU; 8395; -.
Ensembl; ENST00000265382; ENSP00000265382; ENSG00000107242. [O14986-1]
Ensembl; ENST00000478500; ENSP00000435778; ENSG00000107242. [O14986-2]
Ensembl; ENST00000541509; ENSP00000438082; ENSG00000107242. [O14986-3]
GeneID; 8395; -.
KEGG; hsa:8395; -.
UCSC; uc004agu.5; human. [O14986-1]
CTD; 8395; -.
DisGeNET; 8395; -.
EuPathDB; HostDB:ENSG00000107242.17; -.
GeneCards; PIP5K1B; -.
HGNC; HGNC:8995; PIP5K1B.
HPA; HPA009687; -.
MIM; 602745; gene.
neXtProt; NX_O14986; -.
OpenTargets; ENSG00000107242; -.
PharmGKB; PA33328; -.
eggNOG; KOG0229; Eukaryota.
eggNOG; COG5253; LUCA.
GeneTree; ENSGT00760000119184; -.
HOVERGEN; HBG052818; -.
InParanoid; O14986; -.
KO; K00889; -.
OMA; HYPHDRT; -.
OrthoDB; EOG091G0A6L; -.
PhylomeDB; O14986; -.
TreeFam; TF319618; -.
BioCyc; MetaCyc:HS02982-MONOMER; -.
Reactome; R-HSA-1660499; Synthesis of PIPs at the plasma membrane.
Reactome; R-HSA-201688; WNT mediated activation of DVL.
Reactome; R-HSA-6811558; PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling.
SABIO-RK; O14986; -.
SIGNOR; O14986; -.
ChiTaRS; PIP5K1B; human.
GeneWiki; PIP5K1B; -.
GenomeRNAi; 8395; -.
PRO; PR:O14986; -.
Proteomes; UP000005640; Chromosome 9.
Bgee; ENSG00000107242; -.
ExpressionAtlas; O14986; baseline and differential.
Genevisible; O14986; HS.
GO; GO:0005829; C:cytosol; TAS:Reactome.
GO; GO:0012505; C:endomembrane system; IEA:UniProtKB-SubCell.
GO; GO:0016020; C:membrane; IEA:UniProtKB-KW.
GO; GO:0001931; C:uropod; IDA:UniProtKB.
GO; GO:0052811; F:1-phosphatidylinositol-3-phosphate 4-kinase activity; TAS:Reactome.
GO; GO:0000285; F:1-phosphatidylinositol-3-phosphate 5-kinase activity; TAS:Reactome.
GO; GO:0016308; F:1-phosphatidylinositol-4-phosphate 5-kinase activity; TAS:Reactome.
GO; GO:0052810; F:1-phosphatidylinositol-5-kinase activity; TAS:Reactome.
GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
GO; GO:0052812; F:phosphatidylinositol-3,4-bisphosphate 5-kinase activity; TAS:Reactome.
GO; GO:0006661; P:phosphatidylinositol biosynthetic process; TAS:Reactome.
GO; GO:0014066; P:regulation of phosphatidylinositol 3-kinase signaling; TAS:Reactome.
Gene3D; 3.30.800.10; -; 1.
Gene3D; 3.30.810.10; -; 2.
InterPro; IPR023610; PInositol-4-P-5-kinase.
InterPro; IPR027483; PInositol-4-P-5-kinase_C.
InterPro; IPR002498; PInositol-4-P-5-kinase_core.
InterPro; IPR027484; PInositol-4-P-5-kinase_N.
PANTHER; PTHR23086; PTHR23086; 1.
Pfam; PF01504; PIP5K; 1.
SMART; SM00330; PIPKc; 1.
PROSITE; PS51455; PIPK; 1.
1: Evidence at protein level;
Alternative splicing; ATP-binding; Complete proteome; Kinase;
Membrane; Nucleotide-binding; Phosphoprotein; Polymorphism;
Reference proteome; Transferase.
CHAIN 1 540 Phosphatidylinositol 4-phosphate 5-kinase
type-1 beta.
/FTId=PRO_0000185458.
DOMAIN 25 395 PIPK. {ECO:0000255|PROSITE-
ProRule:PRU00781}.
MOD_RES 445 445 Phosphoserine.
{ECO:0000250|UniProtKB:P70181}.
MOD_RES 447 447 Phosphoserine.
{ECO:0000250|UniProtKB:P70181}.
MOD_RES 448 448 Phosphoserine.
{ECO:0000250|UniProtKB:P70181}.
VAR_SEQ 24 24 T -> TQVKNQILSRLPKIPCTFIQAWTNTEMITLLACYYF
RSVST (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_016010.
VAR_SEQ 501 540 SKGLPSSSTFTLEEGTIYLTAEPNTLEVQDDNASVLDVYL
-> RFKMATSEH (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_016011.
VAR_SEQ 503 540 Missing (in isoform 3).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_054771.
VARIANT 415 415 A -> T (in dbSNP:rs55897616).
{ECO:0000269|PubMed:9177790}.
/FTId=VAR_023712.
CONFLICT 346 346 M -> T (in Ref. 6; AAH30587).
{ECO:0000305}.
SEQUENCE 540 AA; 61036 MW; 7A683794A39A20B6 CRC64;
MSSAAENGEA APGKQNEEKT YKKTASSAIK GAIQLGIGYT VGNLTSKPER DVLMQDFYVV
ESVFLPSEGS NLTPAHHYPD FRFKTYAPLA FRYFRELFGI KPDDYLYSIC SEPLIELSNP
GASGSLFFVT SDDEFIIKTV QHKEAEFLQK LLPGYYMNLN QNPRTLLPKF YGLYCMQSGG
INIRIVVMNN VLPRSMRMHF TYDLKGSTYK RRASRKEREK SNPTFKDLDF LQDMHEGLYF
DTETYNALMK TLQRDCRVLE SFKIMDYSLL LGIHFLDHSL KEKEEETPQN VPDAKRTGMQ
KVLYSTAMES IQGPGKSGDG IITENPDTMG GIPAKSHRGE KLLLFMGIID ILQSYRLMKK
LEHSWKALVY DGDTVSVHRP SFYADRFLKF MNSRVFKKIQ ALKASPSKKR CNSIAALKAT
SQEIVSSISQ EWKDEKRDLL TEGQSFSSLD EEALGSRHRP DLVPSTPSLF EAASLATTIS
SSSLYVNEHY PHDRPTLYSN SKGLPSSSTF TLEEGTIYLT AEPNTLEVQD DNASVLDVYL


Related products :

Catalog number Product name Quantity
EIAAB31019 Homo sapiens,Human,Phosphatidylinositol-4-phosphate 5-kinase type I beta,Phosphatidylinositol-4-phosphate 5-kinase type-1 beta,PIP5K1B,PIP5K1-beta,PIP5KIbeta,Protein STM-7,PtdIns(4)P-5-kinase 1 beta,S
EIAAB31016 Chicken,Gallus gallus,Phosphatidylinositol-4-phosphate 5-kinase type I beta,Phosphatidylinositol-4-phosphate 5-kinase type-1 beta,PIP5K1B,PIP5K1-beta,PIP5KIbeta,PtdIns(4)P-5-kinase 1 beta,RCJMB04_20j1
EIAAB31017 Phosphatidylinositol-4-phosphate 5-kinase type I alpha,Phosphatidylinositol-4-phosphate 5-kinase type I beta,Phosphatidylinositol-4-phosphate 5-kinase type-1 beta,Pip5k1a,Pip5k1b,PIP5K1-beta,PIP5KIalp
EIAAB30999 1-phosphatidylinositol-5-phosphate 4-kinase 2-beta,Diphosphoinositide kinase 2-beta,Homo sapiens,Human,Phosphatidylinositol-5-phosphate 4-kinase type II beta,Phosphatidylinositol-5-phosphate 4-kinase
EIAAB31018 Mouse,Mus musculus,Phosphatidylinositol-4-phosphate 5-kinase type I alpha,Phosphatidylinositol-4-phosphate 5-kinase type I beta,Phosphatidylinositol-4-phosphate 5-kinase type-1 beta,Pip5k1a,Pip5k1b,PI
EIAAB31001 1-phosphatidylinositol-5-phosphate 4-kinase 2-beta,Diphosphoinositide kinase 2-beta,Mouse,Mus musculus,Phosphatidylinositol-5-phosphate 4-kinase type II beta,Phosphatidylinositol-5-phosphate 4-kinase
EIAAB31000 1-phosphatidylinositol-5-phosphate 4-kinase 2-beta,Diphosphoinositide kinase 2-beta,Phosphatidylinositol-5-phosphate 4-kinase type II beta,Phosphatidylinositol-5-phosphate 4-kinase type-2 beta,Phospha
EIAAB31014 68 kDa type I phosphatidylinositol-4-phosphate 5-kinase,Mouse,Mus musculus,Phosphatidylinositol-4-phosphate 5-kinase type I alpha,Phosphatidylinositol-4-phosphate 5-kinase type I beta,Phosphatidylinos
EIAAB31022 Homo sapiens,Human,KIAA0589,Phosphatidylinositol-4-phosphate 5-kinase type I gamma,Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma,PIP5K1C,PIP5K1-gamma,PIP5KIgamma,PtdIns(4)P-5-kinase 1 gamma
EIAAB31021 Kiaa0589,Mouse,Mus musculus,Phosphatidylinositol-4-phosphate 5-kinase type I gamma,Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma,Pip5k1c,PIP5K1-gamma,PIP5KIgamma,PtdIns(4)P-5-kinase 1 gamma
EIAAB31020 Phosphatidylinositol-4-phosphate 5-kinase type I gamma,Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma,Pip5k1c,PIP5K1-gamma,PIP5KIgamma,PtdIns(4)P-5-kinase 1 gamma,Rat,Rattus norvegicus
EIAAB29520 C2-PI3K,Homo sapiens,Human,Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta,Phosphoinositide 3-kinase-C2-beta,PI3K-C2-beta,PIK3C2B,PtdIns-3-kinase C2 subunit beta
EIAAB29557 Homo sapiens,Human,Phosphatidylinositol 4-kinase type 2-beta,Phosphatidylinositol 4-kinase type II-beta,PI4K2B,PI4KII-BETA
EIAAB30994 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha,Diphosphoinositide kinase 2-alpha,Homo sapiens,Human,Phosphatidylinositol-5-phosphate 4-kinase type II alpha,Phosphatidylinositol-5-phosphate 4-kina
EIAAB31015 68 kDa type I phosphatidylinositol-4-phosphate 5-kinase alpha,Homo sapiens,Human,Phosphatidylinositol-4-phosphate 5-kinase type I alpha,Phosphatidylinositol-4-phosphate 5-kinase type-1 alpha,PIP5K1A,P
EIAAB30996 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha,Diphosphoinositide kinase 2-alpha,Mouse,Mus musculus,Phosphatidylinositol-5-phosphate 4-kinase type II alpha,Phosphatidylinositol-5-phosphate 4-kina
RPK-053 Recombinant Human Phosphatidylinositol-5-Phosphate 4-Kinase, Type II, Beta 2
pka-053 Recombinant Human Phosphatidylinositol-5-Phosphate 4-Kinase, Type II, Beta 10
pka-053 Recombinant Human Phosphatidylinositol-5-Phosphate 4-Kinase, Type II, Beta 1mg
PI42B_RAT Rat ELISA Kit FOR Phosphatidylinositol-5-phosphate 4-kinase type-2 beta 96T
pka-053 Recombinant Human Phosphatidylinositol-5-Phosphate 4-Kinase, Type II, Beta 2
EIAAB31025 Mouse,Mus musculus,Phosphatidylinositol phosphate kinase homolog,Phosphatidylinositol-4-phosphate 5-kinase-like protein 1,PI(4)P 5-kinase-like protein 1,Pip5kl1,PIPKH,Pipkh,PtdIns(4)P-5-kinase-like pr
PIP5K1A PIP4K2B Gene phosphatidylinositol-5-phosphate 4-kinase, type II, beta
201-20-4246 PIP5K1B{phosphatidylinositol-4-phosphate 5-kinase, type I, beta}rabbit.pAb 0.2ml
201-20-4244 PIP4K2B{phosphatidylinositol-5-phosphate 4-kinase, type II, beta}rabbit.pAb 0.2ml


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur