Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic (Lhca3*1) (LHCI type III LHCA3)

 LHCA3_ARATH             Reviewed;         273 AA.
Q9SY97; Q0WR83; Q2V2R9; Q43381; Q8LCR7;
17-FEB-2016, integrated into UniProtKB/Swiss-Prot.
01-MAY-2000, sequence version 1.
10-OCT-2018, entry version 136.
RecName: Full=Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic {ECO:0000303|PubMed:8115553};
Short=Lhca3*1 {ECO:0000303|PubMed:8115553};
AltName: Full=LHCI type III LHCA3 {ECO:0000305};
Flags: Precursor;
Name=LHCA3 {ECO:0000303|PubMed:8115553};
OrderedLocusNames=At1g61520 {ECO:0000312|Araport:AT1G61520};
ORFNames=T25B24.12 {ECO:0000312|EMBL:AAD25555.1};
Arabidopsis thaliana (Mouse-ear cress).
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae;
Arabidopsis.
NCBI_TaxID=3702;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
STRAIN=cv. Columbia; TISSUE=Leaf;
PubMed=8115553; DOI=10.1104/pp.104.1.297;
Wang J., Zhang H., Goodman H.M.;
"An Arabidopsis cab gene homologous to Cab-8 of tomato.";
Plant Physiol. 104:297-297(1994).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=cv. Columbia;
PubMed=11130712; DOI=10.1038/35048500;
Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S.,
White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y.,
Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W.,
Chung M.K., Conn L., Conway A.B., Conway A.R., Creasy T.H., Dewar K.,
Dunn P., Etgu P., Feldblyum T.V., Feng J.-D., Fong B., Fujii C.Y.,
Gill J.E., Goldsmith A.D., Haas B., Hansen N.F., Hughes B., Huizar L.,
Hunter J.L., Jenkins J., Johnson-Hopson C., Khan S., Khaykin E.,
Kim C.J., Koo H.L., Kremenetskaia I., Kurtz D.B., Kwan A., Lam B.,
Langin-Hooper S., Lee A., Lee J.M., Lenz C.A., Li J.H., Li Y.-P.,
Lin X., Liu S.X., Liu Z.A., Luros J.S., Maiti R., Marziali A.,
Militscher J., Miranda M., Nguyen M., Nierman W.C., Osborne B.I.,
Pai G., Peterson J., Pham P.K., Rizzo M., Rooney T., Rowley D.,
Sakano H., Salzberg S.L., Schwartz J.R., Shinn P., Southwick A.M.,
Sun H., Tallon L.J., Tambunga G., Toriumi M.J., Town C.D.,
Utterback T., Van Aken S., Vaysberg M., Vysotskaia V.S., Walker M.,
Wu D., Yu G., Fraser C.M., Venter J.C., Davis R.W.;
"Sequence and analysis of chromosome 1 of the plant Arabidopsis
thaliana.";
Nature 408:816-820(2000).
[3]
GENOME REANNOTATION.
STRAIN=cv. Columbia;
PubMed=27862469; DOI=10.1111/tpj.13415;
Cheng C.Y., Krishnakumar V., Chan A.P., Thibaud-Nissen F., Schobel S.,
Town C.D.;
"Araport11: a complete reannotation of the Arabidopsis thaliana
reference genome.";
Plant J. 89:789-804(2017).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
STRAIN=cv. Columbia;
PubMed=14593172; DOI=10.1126/science.1088305;
Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J.,
Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F.,
Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.,
Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J.,
Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y.,
Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P.,
Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F.,
Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M.,
Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J.,
Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T.,
Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y.,
Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
"Empirical analysis of transcriptional activity in the Arabidopsis
genome.";
Science 302:842-846(2003).
[5]
INTERACTION WITH LHCA5, AND INDUCTION BY LIGHT AND COLD.
STRAIN=cv. C24, and cv. Columbia;
PubMed=15356385; DOI=10.1023/B:PLAN.0000040813.05224.94;
Ganeteg U., Klimmek F., Jansson S.;
"Lhca5--an LHC-type protein associated with photosystem I.";
Plant Mol. Biol. 54:641-651(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
STRAIN=cv. Columbia;
Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A.,
Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y.,
Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.,
Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
Hayashizaki Y., Shinozaki K.;
"Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs.";
Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Brover V.V., Troukhan M.E., Alexandrov N.A., Lu Y.-P., Flavell R.B.,
Feldmann K.A.;
"Full-length cDNA from Arabidopsis thaliana.";
Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases.
[8]
GENE FAMILY, AND NOMENCLATURE.
PubMed=10366881; DOI=10.1016/S1360-1385(99)01419-3;
Jansson S.;
"A guide to the Lhc genes and their relatives in Arabidopsis.";
Trends Plant Sci. 4:236-240(1999).
[9]
SUBCELLULAR LOCATION.
STRAIN=cv. Columbia;
PubMed=10818090; DOI=10.1074/jbc.M000550200;
Jensen P.E., Gilpin M., Knoetzel J., Scheller H.V.;
"The PSI-K subunit of photosystem I is involved in the interaction
between light-harvesting complex I and the photosystem I reaction
center core.";
J. Biol. Chem. 275:24701-24708(2000).
[10]
DISRUPTION PHENOTYPE, AND BIOPHYSICOCHEMICAL PROPERTIES.
STRAIN=cv. Columbia;
PubMed=11553743; DOI=10.1104/pp.127.1.150;
Ganeteg U., Strand A., Gustafsson P., Jansson S.;
"The properties of the chlorophyll a/b-binding proteins Lhca2 and
Lhca3 studied in vivo using antisense inhibition.";
Plant Physiol. 127:150-158(2001).
[11]
REVIEW ON PHOTOSYSTEM I ANTENNA.
PubMed=12324436; DOI=10.1016/S0006-3495(02)73979-9;
Ihalainen J.A., Jensen P.E., Haldrup A., van Stokkum I.H.M.,
van Grondelle R., Scheller H.V., Dekker J.P.;
"Pigment organization and energy transfer dynamics in isolated
photosystem I (PSI) complexes from Arabidopsis thaliana depleted of
the PSI-G, PSI-K, PSI-L, or PSI-N subunit.";
Biophys. J. 83:2190-2201(2002).
[12]
COFACTOR.
PubMed=15563470; DOI=10.1074/jbc.M411248200;
Storf S., Jansson S., Schmid V.H.R.;
"Pigment binding, fluorescence properties, and oligomerization
behavior of Lhca5, a novel light-harvesting protein.";
J. Biol. Chem. 280:5163-5168(2005).
[13]
MUTAGENESIS OF GLU-100; ASN-103; ARG-105; GLU-159; GLU-167; ARG-170;
GLU-225; ASN-228; ARG-230; GLN-242 AND HIS-257.
PubMed=16950167; DOI=10.1016/j.bbabio.2006.06.018;
Mozzo M., Morosinotto T., Bassi R., Croce R.;
"Probing the structure of Lhca3 by mutation analysis.";
Biochim. Biophys. Acta 1757:1607-1613(2006).
[14]
INTERACTION WITH LHCA2.
STRAIN=cv. Columbia;
PubMed=17107674; DOI=10.1016/j.febslet.2006.10.063;
Lucinski R., Schmid V.H., Jansson S., Klimmek F.;
"Lhca5 interaction with plant photosystem I.";
FEBS Lett. 580:6485-6488(2006).
[15]
INTERACTION WITH CAROTENOIDS, AND COFACTOR.
PubMed=17326666; DOI=10.1021/bi602531k;
Croce R., Mozzo M., Morosinotto T., Romeo A., Hienerwadel R.,
Bassi R.;
"Singlet and triplet state transitions of carotenoids in the antenna
complexes of higher-plant photosystem I.";
Biochemistry 46:3846-3855(2007).
[16]
COFACTOR, AND SUBUNIT.
PubMed=19139095; DOI=10.1074/jbc.M808395200;
Wientjes E., Oostergetel G.T., Jansson S., Boekema E.J., Croce R.;
"The role of Lhca complexes in the supramolecular organization of
higher plant photosystem I.";
J. Biol. Chem. 284:7803-7810(2009).
[17]
SUBUNIT, AND COFACTOR.
STRAIN=cv. Columbia;
PubMed=21083539; DOI=10.1042/BJ20101538;
Wientjes E., Croce R.;
"The light-harvesting complexes of higher-plant Photosystem I: Lhca1/4
and Lhca2/3 form two red-emitting heterodimers.";
Biochem. J. 433:477-485(2011).
[18]
FUNCTION, AND MISCELLANEOUS.
PubMed=21806943; DOI=10.1016/j.bpj.2011.06.045;
Wientjes E., van Stokkum I.H.M., van Amerongen H., Croce R.;
"The role of the individual Lhcas in photosystem I excitation energy
trapping.";
Biophys. J. 101:745-754(2011).
[19]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-195, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=22092075; DOI=10.1021/pr200917t;
Aryal U.K., Krochko J.E., Ross A.R.;
"Identification of phosphoproteins in Arabidopsis thaliana leaves
using polyethylene glycol fractionation, immobilized metal-ion
affinity chromatography, two-dimensional gel electrophoresis and mass
spectrometry.";
J. Proteome Res. 11:425-437(2012).
[20]
X-RAY CRYSTALLOGRAPHY (3.40 ANGSTROMS) OF 95-259, SUBUNIT, AND
COFACTOR.
PubMed=17476261; DOI=10.1038/nature05687;
Amunts A., Drory O., Nelson N.;
"The structure of a plant photosystem I supercomplex at 3.4 A
resolution.";
Nature 447:58-63(2007).
-!- FUNCTION: The light-harvesting complex (LHC) functions as a light
receptor, it captures and delivers excitation energy to
photosystems with which it is closely associated, here photosystem
I. {ECO:0000269|PubMed:21806943}.
-!- COFACTOR:
Note=Binds at least 14 chlorophylls (8 Chl-a and 6 Chl-b) and
carotenoids such as lutein and neoxanthin.
{ECO:0000269|PubMed:15563470, ECO:0000269|PubMed:17326666,
ECO:0000269|PubMed:17476261, ECO:0000269|PubMed:19139095,
ECO:0000269|PubMed:21083539};
-!- BIOPHYSICOCHEMICAL PROPERTIES:
Absorption:
Abs(max)=~715 nm;
Note=Emission maxima at 735 nm. {ECO:0000269|PubMed:11553743};
-!- SUBUNIT: The LHC complex consists of chlorophyll a-b binding
proteins (PubMed:19139095, PubMed:17476261). Red-emitting
heterodimer with LHCA2 (PubMed:17107674, PubMed:21083539).
Interacts with LHCA5 (PubMed:15356385). Binds to carotenoids
(PubMed:17326666). {ECO:0000269|PubMed:15356385,
ECO:0000269|PubMed:17107674, ECO:0000269|PubMed:17326666,
ECO:0000269|PubMed:17476261, ECO:0000269|PubMed:19139095,
ECO:0000269|PubMed:21083539}.
-!- SUBCELLULAR LOCATION: Plastid, chloroplast thylakoid membrane
{ECO:0000269|PubMed:10818090}; Multi-pass membrane protein
{ECO:0000255}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q9SY97-1; Sequence=Displayed;
Name=2;
IsoId=Q9SY97-2; Sequence=VSP_058097;
Note=Derived from EST data. No experimental confirmation
available. {ECO:0000312|EMBL:AEE33847.1};
-!- INDUCTION: Induced by low light (LL) but repressed by high light
(HL). Inhibited by cold. {ECO:0000269|PubMed:15356385}.
-!- DOMAIN: The N-terminus of the protein extends into the stroma
where it is involved with adhesion of granal membranes and post-
translational modifications; both are believed to mediate the
distribution of excitation energy between photosystems I and II.
{ECO:0000305}.
-!- PTM: Photoregulated by reversible phosphorylation of its threonine
residues. {ECO:0000250|UniProtKB:P12333}.
-!- DISRUPTION PHENOTYPE: Slight decrease (30 percent) of LHCA2 levels
(at protein level). {ECO:0000269|PubMed:11553743}.
-!- MISCELLANEOUS: Light emission at 715-720 nm upon excitation at 440
and 475 nm, and subsequent transfer of excitation energy to the
photosystem I core with a relative slow rate of 25 ns(-1).
{ECO:0000269|PubMed:21806943}.
-!- SIMILARITY: Belongs to the light-harvesting chlorophyll a/b-
binding (LHC) protein family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; U01103; AAA18206.1; -; mRNA.
EMBL; AC005850; AAD25555.1; -; Genomic_DNA.
EMBL; CP002684; AEE33846.1; -; Genomic_DNA.
EMBL; CP002684; AEE33847.1; -; Genomic_DNA.
EMBL; CP002684; AEE33848.1; -; Genomic_DNA.
EMBL; AY059879; AAL24361.1; -; mRNA.
EMBL; AY093370; AAM13369.1; -; mRNA.
EMBL; AK228436; BAF00366.1; -; mRNA.
EMBL; AY086439; AAM63442.1; -; mRNA.
PIR; E96640; E96640.
RefSeq; NP_001031217.1; NM_001036140.1. [Q9SY97-2]
RefSeq; NP_001185280.1; NM_001198351.1. [Q9SY97-1]
RefSeq; NP_176347.1; NM_104833.3. [Q9SY97-1]
UniGene; At.20472; -.
UniGene; At.21403; -.
UniGene; At.2877; -.
UniGene; At.71924; -.
UniGene; At.71944; -.
PDB; 2O01; X-ray; 3.40 A; 3=95-259.
PDBsum; 2O01; -.
ProteinModelPortal; Q9SY97; -.
SMR; Q9SY97; -.
STRING; 3702.AT1G61520.1; -.
TCDB; 5.B.4.1.1; the plant photosystem i supercomplex (psi) family.
iPTMnet; Q9SY97; -.
PaxDb; Q9SY97; -.
PRIDE; Q9SY97; -.
ProMEX; Q9SY97; -.
EnsemblPlants; AT1G61520.1; AT1G61520.1; AT1G61520. [Q9SY97-1]
EnsemblPlants; AT1G61520.2; AT1G61520.2; AT1G61520. [Q9SY97-2]
EnsemblPlants; AT1G61520.3; AT1G61520.3; AT1G61520. [Q9SY97-1]
GeneID; 842446; -.
Gramene; AT1G61520.1; AT1G61520.1; AT1G61520. [Q9SY97-1]
Gramene; AT1G61520.2; AT1G61520.2; AT1G61520. [Q9SY97-2]
Gramene; AT1G61520.3; AT1G61520.3; AT1G61520. [Q9SY97-1]
KEGG; ath:AT1G61520; -.
Araport; AT1G61520; -.
TAIR; locus:2200868; AT1G61520.
eggNOG; ENOG410IHHS; Eukaryota.
eggNOG; ENOG410ZM8E; LUCA.
HOGENOM; HOG000238033; -.
InParanoid; Q9SY97; -.
KO; K08909; -.
OMA; WLAYSEV; -.
OrthoDB; EOG09360J56; -.
PhylomeDB; Q9SY97; -.
PRO; PR:Q9SY97; -.
Proteomes; UP000006548; Chromosome 1.
ExpressionAtlas; Q9SY97; baseline and differential.
GO; GO:0009507; C:chloroplast; IDA:TAIR.
GO; GO:0009941; C:chloroplast envelope; IBA:GO_Central.
GO; GO:0009534; C:chloroplast thylakoid; IDA:TAIR.
GO; GO:0009535; C:chloroplast thylakoid membrane; IDA:UniProtKB.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0016020; C:membrane; IDA:TAIR.
GO; GO:0009522; C:photosystem I; IEA:UniProtKB-KW.
GO; GO:0010287; C:plastoglobule; IDA:TAIR.
GO; GO:0009579; C:thylakoid; IDA:TAIR.
GO; GO:0016168; F:chlorophyll binding; IBA:GO_Central.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0031409; F:pigment binding; IBA:GO_Central.
GO; GO:0019904; F:protein domain specific binding; IPI:CAFA.
GO; GO:0009768; P:photosynthesis, light harvesting in photosystem I; IDA:UniProtKB.
GO; GO:0018298; P:protein-chromophore linkage; IEA:UniProtKB-KW.
GO; GO:0009409; P:response to cold; IEP:UniProtKB.
GO; GO:0009735; P:response to cytokinin; IDA:TAIR.
GO; GO:0009644; P:response to high light intensity; IEP:UniProtKB.
GO; GO:0009645; P:response to low light intensity stimulus; IEP:UniProtKB.
Gene3D; 1.10.3460.10; -; 1.
InterPro; IPR001344; Chloro_AB-bd_pln.
InterPro; IPR022796; Chloroa_b-bind.
InterPro; IPR023329; Chlorophyll_a/b-bd_dom_sf.
PANTHER; PTHR21649; PTHR21649; 1.
Pfam; PF00504; Chloroa_b-bind; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Chlorophyll; Chloroplast;
Chromophore; Complete proteome; Magnesium; Membrane; Metal-binding;
Phosphoprotein; Photosynthesis; Photosystem I; Plastid;
Reference proteome; Thylakoid; Transit peptide; Transmembrane;
Transmembrane helix.
TRANSIT 1 39 Chloroplast.
{ECO:0000250|UniProtKB:P12333}.
CHAIN 40 273 Photosystem I chlorophyll a/b-binding
protein 3-1, chloroplastic.
{ECO:0000255}.
/FTId=PRO_0000435448.
TRANSMEM 106 126 Helical. {ECO:0000255}.
TRANSMEM 146 166 Helical. {ECO:0000255}.
TRANSMEM 231 251 Helical. {ECO:0000255}.
METAL 56 56 Magnesium (chlorophyll-b 1 axial ligand);
via carbonyl oxygen.
{ECO:0000250|UniProtKB:P12333}.
METAL 100 100 Magnesium (chlorophyll-a 1 axial ligand).
{ECO:0000250|UniProtKB:P12333}.
METAL 140 140 Magnesium (chlorophyll-b 2 axial ligand);
via carbonyl oxygen.
{ECO:0000250|UniProtKB:P12333}.
METAL 167 167 Magnesium (chlorophyll-b 3 axial ligand).
{ECO:0000250|UniProtKB:P12333}.
METAL 225 225 Magnesium (chlorophyll-a 3 axial ligand).
{ECO:0000250|UniProtKB:P12333}.
METAL 228 228 Magnesium (chlorophyll-a 4 axial ligand).
{ECO:0000250|UniProtKB:P12333}.
METAL 242 242 Magnesium (chlorophyll-a 5 axial ligand).
{ECO:0000250|UniProtKB:P12333}.
METAL 257 257 Magnesium (chlorophyll-a 6 axial ligand).
{ECO:0000250|UniProtKB:P12333}.
BINDING 76 76 Chlorophyll-a 1; via amide nitrogen.
{ECO:0000250|UniProtKB:P07371}.
BINDING 82 82 Chlorophyll-a 1.
{ECO:0000250|UniProtKB:P07371}.
BINDING 105 105 Chlorophyll-b 2.
{ECO:0000250|UniProtKB:P07371}.
BINDING 170 170 Chlorophyll-b 4.
{ECO:0000250|UniProtKB:P07371}.
BINDING 224 224 Chlorophyll-a 5.
{ECO:0000250|UniProtKB:P07371}.
BINDING 230 230 Chlorophyll-a 1.
{ECO:0000250|UniProtKB:P07371}.
BINDING 272 272 Chlorophyll-b 5; via carbonyl oxygen.
{ECO:0000250|UniProtKB:P07371}.
MOD_RES 195 195 Phosphoserine.
{ECO:0000244|PubMed:22092075}.
VAR_SEQ 1 68 MAAQALVSSSLTSSVQTARQIFGSKPVASASQKKSSFVVKA
AATPPVKQGANRPLWFASSQSLSYLDG -> MMFKIWRCSD
SSC (in isoform 2).
/FTId=VSP_058097.
MUTAGEN 100 100 E->V: Impaired complex formation with
chlorophyll; when associated with L-230.
{ECO:0000269|PubMed:16950167}.
MUTAGEN 103 103 N->F: Reduced chlorophyll-b content in
pigment complex.
{ECO:0000269|PubMed:16950167}.
MUTAGEN 105 105 R->L: Impaired complex formation with
chlorophyll; when associated with V-225.
{ECO:0000269|PubMed:16950167}.
MUTAGEN 159 159 E->V: Reduced chlorophyll-a content in
pigment complex.
{ECO:0000269|PubMed:16950167}.
MUTAGEN 167 167 E->V: Reduced chlorophyll-a and
chlorophyll-b content in pigment complex;
when associated with L-170.
{ECO:0000269|PubMed:16950167}.
MUTAGEN 170 170 R->L: Reduced chlorophyll-a and
chlorophyll-b content in pigment complex;
when associated with V-167.
{ECO:0000269|PubMed:16950167}.
MUTAGEN 225 225 E->V: Impaired complex formation with
chlorophyll; when associated with L-105.
{ECO:0000269|PubMed:16950167}.
MUTAGEN 228 228 N->V: Reduced chlorophyll-a content in
pigment complex.
{ECO:0000269|PubMed:16950167}.
MUTAGEN 230 230 R->L: Impaired complex formation with
chlorophyll; when associated with V-100.
{ECO:0000269|PubMed:16950167}.
MUTAGEN 242 242 Q->L: Impaired complex formation with
chlorophyll.
{ECO:0000269|PubMed:16950167}.
MUTAGEN 257 257 H->F: Reduced chlorophyll-a content in
pigment complex.
{ECO:0000269|PubMed:16950167}.
CONFLICT 44 44 T -> A (in Ref. 1; AAA18206).
{ECO:0000305}.
CONFLICT 57 57 F -> V (in Ref. 1; AAA18206).
{ECO:0000305}.
CONFLICT 260 260 D -> G (in Ref. 6; BAF00366).
{ECO:0000305}.
HELIX 102 114 {ECO:0000244|PDB:2O01}.
TURN 115 117 {ECO:0000244|PDB:2O01}.
STRAND 125 127 {ECO:0000244|PDB:2O01}.
STRAND 147 149 {ECO:0000244|PDB:2O01}.
STRAND 151 154 {ECO:0000244|PDB:2O01}.
HELIX 159 166 {ECO:0000244|PDB:2O01}.
HELIX 168 172 {ECO:0000244|PDB:2O01}.
TURN 173 177 {ECO:0000244|PDB:2O01}.
STRAND 179 181 {ECO:0000244|PDB:2O01}.
HELIX 227 241 {ECO:0000244|PDB:2O01}.
TURN 242 246 {ECO:0000244|PDB:2O01}.
STRAND 253 255 {ECO:0000244|PDB:2O01}.
SEQUENCE 273 AA; 29181 MW; C7EE634D155274F4 CRC64;
MAAQALVSSS LTSSVQTARQ IFGSKPVASA SQKKSSFVVK AAATPPVKQG ANRPLWFASS
QSLSYLDGSL PGDYGFDPLG LSDPEGTGGF IEPRWLAYGE IINGRFAMLG AAGAIAPEIL
GKAGLIPAET ALPWFQTGVI PPAGTYTYWA DNYTLFVLEM ALMGFAEHRR LQDWYNPGSM
GKQYFLGLEK GLAGSGNPAY PGGPFFNPLG FGKDEKSLKE LKLKEVKNGR LAMLAILGYF
IQGLVTGVGP YQNLLDHLAD PVNNNVLTSL KFH


Related products :

Catalog number Product name Quantity
AS01 007 Antibody: Lhca3 | PSI type III chlorophyll a_b-binding protein, Immunogen: BSA-conjugated synthetic peptide derived from the Lhca3 protein sequence from Arabidopsis thaliana (At1g61520). This sequence 200
AS01 007 rabbit polyclonal Lhca3 | PSI type III chlorophyll a per b-binding protein 200
AS01007 Lhca3 | PSI type III chlorophyll a_b_binding protein 200 ul
AS01 007 Lhca3 | PSI type III chlorophyll a_b_binding protein 200 ul
20312144-1 Lhca3 | PSI type III chlorophyll a_b-bin 200 uL
AS01 007 LHCA3 0.2 ml
AS01007 LHCA3 0.2 ml
AS01 007 LHCA3 0.2 ml
'AS01 007 LHCA3 antibody Ab host: Rabbit 0.2 ml
'AS01 007 LHCA3 antibody Host rabbit 50
AS05 082 rabbit polyclonal Lhca5 | PSI type V chlorophyll a per b-binding protein 200
AS01 008 rabbit polyclonal Lhca4 | PSI type IV chlorophyll a per b-binding protein 200
AS01 004-10 Antibody: Lhcb1 | LHCII type I chlorophyll a_b-binding protein (10 10
AS01 005 rabbit polyclonal Lhca1 | PSI type I chlorophyll a per b-binding protein 200
AS01 002 rabbit polyclonal Lhcb3 | LHCII type III chlorophyll a per b-binding protein 200
AS09 522 rabbit polyclonal Lhcb1 | LHCII type I chlorophyll a per b-binding protein 100
AS01 003 rabbit polyclonal Lhcb2 | LHCII type II chlorophyll a per b-binding protein 200
AS01 004-100 rabbit polyclonal Lhcb1 | LHCII type I chlorophyll a per b-binding protein 2 x 50
AS01 004 rabbit polyclonal Lhcb1 | LHCII type I chlorophyll a per b-binding protein 50
AS13 2704 rabbit polyclonal Lhcb1-P | LHCII type I chlorophyll a per b-binding protein, phopshorylated 25
AS01 002PRE rabbit Lhcb3 | LHCII type III chlorophyll a per b-binding protein, pre-immune serum 200
AS13 2705 rabbit polyclonal Lhcb2-P | LHCII type II chlorophyll a per b-binding protein, phosphorylated 25
AS01 004PRE rabbit Lhcb1 | LHCII type I chlorophyll a per b-binding protein, pre-immune serum 100
AS05 082 Antibody: Lhca5 | PSI type V chlorophyll a_b-binding protein, Immunogen: BSA-conjugated synthetic peptide derived from the Lhca4 protein of Arabidopsis thaliana(At1g45474). This sequence is highly con 200
AS01 004 Lhcb1 | LHCII type I chlorophyll a-b-binding protein Host:rabbit polyclonal antibody affinity purified serum lyophilized 50


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur