Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Plasma membrane calcium-transporting ATPase 2 (PMCA2) (EC 3.6.3.8) (Plasma membrane calcium ATPase isoform 2) (Plasma membrane calcium pump isoform 2)

 AT2B2_RAT               Reviewed;        1243 AA.
P11506; Q63443;
01-OCT-1989, integrated into UniProtKB/Swiss-Prot.
01-JUN-2001, sequence version 2.
22-NOV-2017, entry version 172.
RecName: Full=Plasma membrane calcium-transporting ATPase 2;
Short=PMCA2;
EC=3.6.3.8;
AltName: Full=Plasma membrane calcium ATPase isoform 2;
AltName: Full=Plasma membrane calcium pump isoform 2;
Name=Atp2b2;
Rattus norvegicus (Rat).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
NCBI_TaxID=10116;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
STRAIN=Sprague-Dawley; TISSUE=Brain;
PubMed=2837461;
Shull G.E., Greeb J.;
"Molecular cloning of two isoforms of the plasma membrane Ca2+-
transporting ATPase from rat brain. Structural and functional domains
exhibit similarity to Na+,K+- and other cation transport ATPases.";
J. Biol. Chem. 263:8646-8657(1988).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1083-1243 (ISOFORMS WB/XB/YB/ZB),
AND ALTERNATIVE SPLICING.
PubMed=1315513; DOI=10.1042/bj2830355;
Adamo H.P., Penniston J.T.;
"New Ca2+ pump isoforms generated by alternative splicing of rPMCA2
mRNA.";
Biochem. J. 283:355-359(1992).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1083-1243 (ISOFORMS WB/XB/YB/ZB),
AND ALTERNATIVE SPLICING.
STRAIN=Sprague-Dawley;
PubMed=8428948;
Keeton T.P., Burk S.E., Shull G.E.;
"Alternative splicing of exons encoding the calmodulin-binding domains
and C termini of plasma membrane Ca(2+)-ATPase isoforms 1, 2, 3, and
4.";
J. Biol. Chem. 268:2740-2748(1993).
[4]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-27 AND THR-1188,
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1152 (ISOFORMS WA; WB
AND WC), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1162 AND
SER-1175 (ISOFORM WB), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT
SER-1161 (ISOFORMS WB AND YB), PHOSPHORYLATION [LARGE SCALE ANALYSIS]
AT SER-1121 (ISOFORMS XA; XB AND XC), PHOSPHORYLATION [LARGE SCALE
ANALYSIS] AT SER-1131 AND SER-1144 (ISOFORM XB), PHOSPHORYLATION
[LARGE SCALE ANALYSIS] AT SER-1130 (ISOFORMS XB AND ZB),
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1138 (ISOFORMS YA; YB
AND YC), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1147 AND
SER-1148 (ISOFORM YB), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT
SER-1107 (ISOFORMS ZA; ZB AND ZC), PHOSPHORYLATION [LARGE SCALE
ANALYSIS] AT SER-1116 AND SER-1117 (ISOFORM ZB), AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=22673903; DOI=10.1038/ncomms1871;
Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A.,
Lundby C., Olsen J.V.;
"Quantitative maps of protein phosphorylation sites across 14
different rat organs and tissues.";
Nat. Commun. 3:876-876(2012).
-!- FUNCTION: This magnesium-dependent enzyme catalyzes the hydrolysis
of ATP coupled with the transport of calcium out of the cell.
-!- CATALYTIC ACTIVITY: ATP + H(2)O + Ca(2+)(Side 1) = ADP + phosphate
+ Ca(2+)(Side 2).
-!- SUBUNIT: Interacts with PDZD11. {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Cell junction, synapse
{ECO:0000250|UniProtKB:Q9R0K7}. Cell membrane {ECO:0000255};
Multi-pass membrane protein {ECO:0000255}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=14;
Comment=There is a combination of two alternatively spliced
domains at N-terminal site A (W, X, Y and Z) and at C-terminal
site C (A, B and C). So far the splice sites have only been
studied independently. Experimental confirmation may be lacking
for some isoforms.;
Name=1;
IsoId=P11506-13; Sequence=Displayed;
Name=WB; Synonyms=AIIICI;
IsoId=P11506-1; Sequence=VSP_038681, VSP_038682;
Note=Contains a phosphoserine at position 1152. Contains a
phosphoserine at position 1161. Contains a phosphoserine at
position 1162. Contains a phosphoserine at position 1175.
{ECO:0000244|PubMed:22673903};
Name=WA; Synonyms=AIIICII;
IsoId=P11506-2; Sequence=VSP_000390;
Note=Contains a phosphoserine at position 1152.
{ECO:0000244|PubMed:22673903};
Name=XA; Synonyms=AIICII;
IsoId=P11506-3; Sequence=VSP_000387, VSP_000390;
Note=Contains a phosphoserine at position 1121.
{ECO:0000244|PubMed:22673903};
Name=YA; Synonyms=AIIICII;
IsoId=P11506-4; Sequence=VSP_000389, VSP_000390;
Note=Contains a phosphoserine at position 1138.
{ECO:0000244|PubMed:22673903};
Name=ZA; Synonyms=AICII;
IsoId=P11506-5; Sequence=VSP_000388, VSP_000390;
Note=Contains a phosphoserine at position 1107.
{ECO:0000244|PubMed:22673903};
Name=XB; Synonyms=AIICI;
IsoId=P11506-6; Sequence=VSP_000387, VSP_038681, VSP_038682;
Note=Contains a phosphoserine at position 1121. Contains a
phosphoserine at position 1130. Contains a phosphoserine at
position 1131. Contains a phosphoserine at position 1144.
{ECO:0000244|PubMed:22673903};
Name=YB; Synonyms=AIIICI;
IsoId=P11506-7; Sequence=VSP_000389, VSP_038681, VSP_038682;
Note=Contains a phosphoserine at position 1138. Contains a
phosphoserine at position 1147. Contains a phosphoserine at
position 1148. Contains a phosphoserine at position 1161.
{ECO:0000244|PubMed:22673903};
Name=ZB; Synonyms=AICI;
IsoId=P11506-8; Sequence=VSP_000388, VSP_038681, VSP_038682;
Note=Contains a phosphoserine at position 1107. Contains a
phosphoserine at position 1116. Contains a phosphoserine at
position 1117. Contains a phosphoserine at position 1130.
{ECO:0000244|PubMed:22673903};
Name=WC; Synonyms=AIIICIII;
IsoId=P11506-9; Sequence=VSP_000391;
Note=Contains a phosphoserine at position 1152.
{ECO:0000244|PubMed:22673903};
Name=XC; Synonyms=AIICIII;
IsoId=P11506-10; Sequence=VSP_000387, VSP_000391;
Note=Contains a phosphoserine at position 1121.
{ECO:0000244|PubMed:22673903};
Name=YC; Synonyms=AIIICIII;
IsoId=P11506-11; Sequence=VSP_000389, VSP_000391;
Note=Contains a phosphoserine at position 1138.
{ECO:0000244|PubMed:22673903};
Name=ZC; Synonyms=AICIII;
IsoId=P11506-12; Sequence=VSP_000388, VSP_000391;
Note=Contains a phosphoserine at position 1107.
{ECO:0000244|PubMed:22673903};
Name=2;
IsoId=P11506-14; Sequence=VSP_000388;
-!- TISSUE SPECIFICITY: Isoforms containing segment B are found in
brain, uterus, liver and kidney and in low levels in other
tissues. Isoforms containing segment W are found in kidney,
uterus, and pancreas. Isoforms containing segment Y are found in
pancreas and in low levels in brain and heart. Isoforms containing
segment Z are found in brain and heart and isoforms containing
segment X are found in low levels in brain. Isoforms containing
segment A are found in low levels in heart and small intestine
while isoforms containing segment C are found in testis and in low
levels in other tissues.
-!- SIMILARITY: Belongs to the cation transport ATPase (P-type) (TC
3.A.3) family. Type IIB subfamily. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; J03754; AAA74219.1; -; mRNA.
EMBL; AH005430; AAB60703.1; -; Genomic_DNA.
PIR; B28065; B28065.
RefSeq; NP_036640.1; NM_012508.5. [P11506-14]
UniGene; Rn.90982; -.
ProteinModelPortal; P11506; -.
BioGrid; 246403; 1.
IntAct; P11506; 1.
MINT; MINT-471009; -.
iPTMnet; P11506; -.
PhosphoSitePlus; P11506; -.
PRIDE; P11506; -.
Ensembl; ENSRNOT00000067931; ENSRNOP00000060489; ENSRNOG00000030269. [P11506-14]
GeneID; 24215; -.
KEGG; rno:24215; -.
UCSC; RGD:2176; rat. [P11506-13]
CTD; 491; -.
RGD; 2176; Atp2b2.
GeneTree; ENSGT00510000046331; -.
HOGENOM; HOG000265623; -.
HOVERGEN; HBG061286; -.
InParanoid; P11506; -.
KO; K05850; -.
PhylomeDB; P11506; -.
BRENDA; 3.6.3.8; 5301.
Reactome; R-RNO-418359; Reduction of cytosolic Ca++ levels.
Reactome; R-RNO-5578775; Ion homeostasis.
Reactome; R-RNO-936837; Ion transport by P-type ATPases.
PMAP-CutDB; P11506; -.
PRO; PR:P11506; -.
Proteomes; UP000002494; Chromosome 4.
Bgee; ENSRNOG00000030269; -.
ExpressionAtlas; P11506; baseline and differential.
GO; GO:0016324; C:apical plasma membrane; IDA:RGD.
GO; GO:0030054; C:cell junction; IEA:UniProtKB-KW.
GO; GO:0005929; C:cilium; ISO:RGD.
GO; GO:0005737; C:cytoplasm; ISS:UniProtKB.
GO; GO:0030425; C:dendrite; IDA:RGD.
GO; GO:0005783; C:endoplasmic reticulum; ISO:RGD.
GO; GO:0070062; C:extracellular exosome; ISO:RGD.
GO; GO:0005887; C:integral component of plasma membrane; IBA:GO_Central.
GO; GO:0043231; C:intracellular membrane-bounded organelle; IBA:GO_Central.
GO; GO:0045121; C:membrane raft; IDA:RGD.
GO; GO:0043025; C:neuronal cell body; IDA:RGD.
GO; GO:0032809; C:neuronal cell body membrane; IDA:RGD.
GO; GO:0005886; C:plasma membrane; ISS:UniProtKB.
GO; GO:0098839; C:postsynaptic density membrane; IDA:SynGO.
GO; GO:0033130; F:acetylcholine receptor binding; IDA:RGD.
GO; GO:0005524; F:ATP binding; IDA:RGD.
GO; GO:0005509; F:calcium ion binding; ISS:UniProtKB.
GO; GO:0030899; F:calcium-dependent ATPase activity; ISO:RGD.
GO; GO:0005388; F:calcium-transporting ATPase activity; IDA:RGD.
GO; GO:0005516; F:calmodulin binding; ISS:UniProtKB.
GO; GO:0035254; F:glutamate receptor binding; IPI:RGD.
GO; GO:0030165; F:PDZ domain binding; IPI:RGD.
GO; GO:0008022; F:protein C-terminus binding; ISS:UniProtKB.
GO; GO:0060088; P:auditory receptor cell stereocilium organization; ISO:RGD.
GO; GO:0007420; P:brain development; IEP:RGD.
GO; GO:1901660; P:calcium ion export; IMP:RGD.
GO; GO:0006816; P:calcium ion transport; ISO:RGD.
GO; GO:0000902; P:cell morphogenesis; ISO:RGD.
GO; GO:0006874; P:cellular calcium ion homeostasis; ISO:RGD.
GO; GO:0021707; P:cerebellar granule cell differentiation; ISO:RGD.
GO; GO:0021702; P:cerebellar Purkinje cell differentiation; ISO:RGD.
GO; GO:0021692; P:cerebellar Purkinje cell layer morphogenesis; ISO:RGD.
GO; GO:0021549; P:cerebellum development; ISO:RGD.
GO; GO:0046068; P:cGMP metabolic process; ISO:RGD.
GO; GO:0090102; P:cochlea development; ISO:RGD.
GO; GO:0050910; P:detection of mechanical stimulus involved in sensory perception of sound; ISO:RGD.
GO; GO:0048839; P:inner ear development; ISO:RGD.
GO; GO:0042472; P:inner ear morphogenesis; ISO:RGD.
GO; GO:0060113; P:inner ear receptor cell differentiation; ISO:RGD.
GO; GO:0007595; P:lactation; ISO:RGD.
GO; GO:0040011; P:locomotion; ISO:RGD.
GO; GO:0007626; P:locomotory behavior; ISO:RGD.
GO; GO:0003407; P:neural retina development; IEP:RGD.
GO; GO:0050885; P:neuromuscular process controlling balance; ISO:RGD.
GO; GO:0030182; P:neuron differentiation; ISS:UniProtKB.
GO; GO:0006996; P:organelle organization; ISO:RGD.
GO; GO:0045299; P:otolith mineralization; ISO:RGD.
GO; GO:0051928; P:positive regulation of calcium ion transport; ISO:RGD.
GO; GO:0008361; P:regulation of cell size; ISO:RGD.
GO; GO:0051480; P:regulation of cytosolic calcium ion concentration; ISO:RGD.
GO; GO:0048167; P:regulation of synaptic plasticity; ISO:RGD.
GO; GO:0007605; P:sensory perception of sound; ISS:UniProtKB.
GO; GO:0042428; P:serotonin metabolic process; ISO:RGD.
GO; GO:0050808; P:synapse organization; ISO:RGD.
Gene3D; 3.40.1110.10; -; 2.
InterPro; IPR030322; ATP2B2.
InterPro; IPR022141; ATP_Ca_trans_C.
InterPro; IPR006068; ATPase_P-typ_cation-transptr_C.
InterPro; IPR004014; ATPase_P-typ_cation-transptr_N.
InterPro; IPR023299; ATPase_P-typ_cyto_dom_N.
InterPro; IPR018303; ATPase_P-typ_P_site.
InterPro; IPR023298; ATPase_P-typ_TM_dom_sf.
InterPro; IPR008250; ATPase_P-typ_transduc_dom_A_sf.
InterPro; IPR036412; HAD-like_sf.
InterPro; IPR006408; P-type_ATPase_IIB.
InterPro; IPR001757; P_typ_ATPase.
PANTHER; PTHR24093:SF377; PTHR24093:SF377; 1.
Pfam; PF12424; ATP_Ca_trans_C; 1.
Pfam; PF00689; Cation_ATPase_C; 1.
Pfam; PF00690; Cation_ATPase_N; 1.
SMART; SM00831; Cation_ATPase_N; 1.
SUPFAM; SSF56784; SSF56784; 2.
SUPFAM; SSF81653; SSF81653; 1.
SUPFAM; SSF81660; SSF81660; 1.
SUPFAM; SSF81665; SSF81665; 3.
TIGRFAMs; TIGR01517; ATPase-IIB_Ca; 1.
TIGRFAMs; TIGR01494; ATPase_P-type; 3.
PROSITE; PS00154; ATPASE_E1_E2; 1.
1: Evidence at protein level;
Acetylation; Alternative splicing; ATP-binding; Calcium;
Calcium transport; Calmodulin-binding; Cell junction; Cell membrane;
Complete proteome; Hydrolase; Ion transport; Magnesium; Membrane;
Metal-binding; Nucleotide-binding; Phosphoprotein; Reference proteome;
Synapse; Transmembrane; Transmembrane helix; Transport.
INIT_MET 1 1 Removed. {ECO:0000250|UniProtKB:P20020}.
CHAIN 2 1243 Plasma membrane calcium-transporting
ATPase 2.
/FTId=PRO_0000046216.
TOPO_DOM 2 94 Cytoplasmic. {ECO:0000255}.
TRANSMEM 95 115 Helical. {ECO:0000255}.
TOPO_DOM 116 152 Extracellular. {ECO:0000255}.
TRANSMEM 153 173 Helical. {ECO:0000255}.
TOPO_DOM 174 390 Cytoplasmic. {ECO:0000255}.
TRANSMEM 391 410 Helical. {ECO:0000255}.
TOPO_DOM 411 443 Extracellular. {ECO:0000255}.
TRANSMEM 444 461 Helical. {ECO:0000255}.
TOPO_DOM 462 875 Cytoplasmic. {ECO:0000255}.
TRANSMEM 876 895 Helical. {ECO:0000255}.
TOPO_DOM 896 905 Extracellular. {ECO:0000255}.
TRANSMEM 906 926 Helical. {ECO:0000255}.
TOPO_DOM 927 946 Cytoplasmic. {ECO:0000255}.
TRANSMEM 947 969 Helical. {ECO:0000255}.
TOPO_DOM 970 987 Extracellular. {ECO:0000255}.
TRANSMEM 988 1009 Helical. {ECO:0000255}.
TOPO_DOM 1010 1028 Cytoplasmic. {ECO:0000255}.
TRANSMEM 1029 1050 Helical. {ECO:0000255}.
TOPO_DOM 1051 1060 Extracellular. {ECO:0000255}.
TRANSMEM 1061 1082 Helical. {ECO:0000255}.
TOPO_DOM 1083 1243 Cytoplasmic. {ECO:0000255}.
REGION 1123 1140 Calmodulin-binding subdomain A.
{ECO:0000250}.
REGION 1141 1150 Calmodulin-binding subdomain B.
{ECO:0000250}.
COMPBIAS 294 297 Poly-Glu.
ACT_SITE 499 499 4-aspartylphosphate intermediate.
METAL 820 820 Magnesium. {ECO:0000250}.
METAL 824 824 Magnesium. {ECO:0000250}.
MOD_RES 2 2 N-acetylglycine.
{ECO:0000250|UniProtKB:P20020}.
MOD_RES 18 18 Phosphoserine.
{ECO:0000250|UniProtKB:Q9R0K7}.
MOD_RES 27 27 Phosphoserine.
{ECO:0000244|PubMed:22673903}.
MOD_RES 364 364 Phosphoserine.
{ECO:0000250|UniProtKB:P23634}.
MOD_RES 1139 1139 Phosphothreonine; by PKC.
{ECO:0000250|UniProtKB:P20020}.
MOD_RES 1163 1163 Phosphoserine.
{ECO:0000250|UniProtKB:P11505}.
MOD_RES 1178 1178 Phosphoserine.
{ECO:0000250|UniProtKB:Q9R0K7}.
MOD_RES 1188 1188 Phosphothreonine.
{ECO:0000244|PubMed:22673903}.
MOD_RES 1201 1201 Phosphoserine; by PKA.
{ECO:0000250|UniProtKB:P20020}.
MOD_RES 1205 1205 Phosphoserine.
{ECO:0000250|UniProtKB:P20020}.
MOD_RES 1211 1211 Phosphoserine.
{ECO:0000250|UniProtKB:Q01814}.
VAR_SEQ 303 347 Missing (in isoform 2, isoform ZA,
isoform ZB and isoform ZC).
{ECO:0000303|PubMed:2837461}.
/FTId=VSP_000388.
VAR_SEQ 303 333 Missing (in isoform XA, isoform XB and
isoform XC). {ECO:0000305}.
/FTId=VSP_000387.
VAR_SEQ 334 347 Missing (in isoform YA, isoform YB and
isoform YC). {ECO:0000305}.
/FTId=VSP_000389.
VAR_SEQ 1141 1243 IRVVKAFRSSLYEGLEKPESRTSIHNFMAHPEFRIEDSQPH
IPLIDDTDLEEDAALKQNSSPPSSLNKNNSAIDSGINLTTD
TSKSATSSSPGSPIHSLETSL -> IEVVNTFKSGASFQGA
LRRQSSVTSQSQDVANLSSPSRVSLSNALSSPTSLPPAAAG
QG (in isoform WA, isoform XA, isoform YA
and isoform ZA). {ECO:0000305}.
/FTId=VSP_000390.
VAR_SEQ 1141 1243 IRVVKAFRSSLYEGLEKPESRTSIHNFMAHPEFRIEDSQPH
IPLIDDTDLEEDAALKQNSSPPSSLNKNNSAIDSGINLTTD
TSKSATSSSPGSPIHSLETSL -> IEVVNTFKSGASFQGA
LRRQSSVTSQSQDVANLSSPSRVSLSNALSSPTSLPPAAAG
HPRREGVP (in isoform WC, isoform XC,
isoform YC and isoform ZC).
{ECO:0000305}.
/FTId=VSP_000391.
VAR_SEQ 1141 1141 I -> IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSP
SRVSLSNALSSPTSLPPAAAGI (in isoform WB,
isoform XB, isoform YB and isoform ZB).
{ECO:0000305}.
/FTId=VSP_038681.
VAR_SEQ 1201 1243 Missing (in isoform WB, isoform XB,
isoform YB and isoform ZB).
{ECO:0000305}.
/FTId=VSP_038682.
SEQUENCE 1243 AA; 136811 MW; 1DC324836BFD5D59 CRC64;
MGDMTNSDFY SKNQRNESSH GGEFGCSMEE LRSLMELRGT EAVVKIKETY GDTESICRRL
KTSPVEGLPG TAPDLEKRKQ IFGQNFIPPK KPKTFLQLVW EALQDVTLII LEIAAIISLG
LSFYHPPGES NEGCATAQGG AEDEGEAEAG WIEGAAILLS VICVVLVTAF NDWSKEKQFR
GLQSRIEQEQ KFTVVRAGQV VQIPVAEIVV GDIAQIKYGD LLPADGLFIQ GNDLKIDESS
LTGESDQVRK SVDKDPMLLS GTHVMEGSGR MVVTAVGVNS QTGIIFTLLG AGGEEEEKKD
KKGVKKGDGL QLPAADGAAP ANAAGSANAS LVNGKMQDGS ADSSQSKAKQ QDGAAAMEMQ
PLKSAEGGDA DDKKKANMHK KEKSVLQGKL TKLAVQIGKA GLVMSAITVI ILVLYFTVDT
FVVNKKPWLT ECTPVYVQYF VKFFIIGVTV LVVAVPEGLP LAVTISLAYS VKKMMKDNNL
VRHLDACETM GNATAICSDK TGTLTTNRMT VVQAYVGDVH YKEIPDPSSI NAKTLELLVN
AIAINSAYTT KILPPEKEGA LPRQVGNKTE CGLLGFVLDL RQDYEPVRSQ MPEEKLYKVY
TFNSVRKSMS TVIKMPDESF RMYSKGASEI VLKKCCKILS GAGEPRVFRP RDRDEMVKKV
IEPMACDGLR TICVAYRDFP SSPEPDWDNE NDILNELTCI CVVGIEDPVR PEVPEAIRKC
QRAGITVRMV TGDNINTARA IAIKCGIIHP GEDFLCLEGK EFNRRIRNEK GEIEQERIDK
IWPKLRVLAR SSPTDKHTLV KGIIDSTHTE QRQVVAVTGD GTNDGPALKK ADVGFAMGIA
GTDVAKEASD IILTDDNFSS IVKAVMWGRN VYDSISKFLQ FQLTVNVVAV IVAFTGACIT
QDSPLKAVQM LWVNLIMDTF ASLALATEPP TETLLLRKPY GRNKPLISRT MMKNILGHAV
YQLTLIFTLL FVGEKMFQID SGRNAPLHSP PSEHYTIIFN TFVMMQLFNE INARKIHGER
NVFDGIFRNP IFCTIVLGTF AIQIVIVQFG GKPFSCSPLQ LDQWMWCIFI GLGELVWGQV
IATIPTSRLK FLKEAGRLTQ KEEIPEEELN EDVEEIDHAE RELRRGQILW FRGLNRIQTQ
IRVVKAFRSS LYEGLEKPES RTSIHNFMAH PEFRIEDSQP HIPLIDDTDL EEDAALKQNS
SPPSSLNKNN SAIDSGINLT TDTSKSATSS SPGSPIHSLE TSL


Related products :

Catalog number Product name Quantity
CSB-EL002336RA Rat Plasma membrane calcium-transporting ATPase 2 (PMCA)Elisa kit, Species Rat, Sample Type serum, plasma 96T
CSB-EL002337RA Rat Plasma membrane calcium-transporting ATPase 3(ATP2B3) ELISA kit 96T
E13243r Rabbit ELISA Kit FOR Plasma membrane calcium-transporting ATPase 1 96T
CSB-EL002335RA Rat Plasma membrane calcium-transporting ATPase 1(ATP2B1) ELISA kit 96T
CSB-EL002338RA Rat Plasma membrane calcium-transporting ATPase 4(ATP2B4) ELISA kit 96T
CSB-EL002337RA Rat Plasma membrane calcium-transporting ATPase 3(ATP2B3) ELISA kit SpeciesRat 96T
CSB-EL002335RA Rat Plasma membrane calcium-transporting ATPase 1(ATP2B1) ELISA kit SpeciesRat 96T
CSB-EL002337HU Human Plasma membrane calcium-transporting ATPase 3(ATP2B3) ELISA kit 96T
CSB-EL002336HU Human Plasma membrane calcium-transporting ATPase 2(ATP2B2) ELISA kit 96T
CSB-EL002335CH Chicken Plasma membrane calcium-transporting ATPase 1(ATP2B1) ELISA kit 96T
CSB-EL002338RA Rat Plasma membrane calcium-transporting ATPase 4(ATP2B4) ELISA kit SpeciesRat 96T
CSB-E16201r Rat Plasma membrane calcium-transporting ATPase 2 (PMCA)Elisa kit SpeciesRat 96T
CSB-EL002336MO Mouse Plasma membrane calcium-transporting ATPase 2(ATP2B2) ELISA kit 96T
CSB-EL002338HU Human Plasma membrane calcium-transporting ATPase 4(ATP2B4) ELISA kit 96T
CSB-EL002335PI Pig Plasma membrane calcium-transporting ATPase 1(ATP2B1) ELISA kit SpeciesPig 96T
CSB-EL002335HU Human Plasma membrane calcium-transporting ATPase 1(ATP2B1) ELISA kit 96T
CSB-EL002335CH Chicken Plasma membrane calcium-transporting ATPase 1(ATP2B1) ELISA kit SpeciesChicken 96T
CSB-EL002335RB Rabbit Plasma membrane calcium-transporting ATPase 1(ATP2B1) ELISA kit SpeciesRabbit 96T
AT2B1_RAT ELISA Kit FOR Plasma membrane calcium-transporting ATPase 1; organism: Rat; gene name: Atp2b1 96T
CSB-EL002338HU Human Plasma membrane calcium-transporting ATPase 4(ATP2B4) ELISA kit SpeciesHuman 96T
CSB-EL002337HU Human Plasma membrane calcium-transporting ATPase 3(ATP2B3) ELISA kit SpeciesHuman 96T
CSB-EL002336MO Mouse Plasma membrane calcium-transporting ATPase 2(ATP2B2) ELISA kit SpeciesMouse 96T
CSB-EL002336HU Human Plasma membrane calcium-transporting ATPase 2(ATP2B2) ELISA kit SpeciesHuman 96T
CSB-EL002335HU Human Plasma membrane calcium-transporting ATPase 1(ATP2B1) ELISA kit SpeciesHuman 96T
AT2B4_RAT ELISA Kit FOR Plasma membrane calcium-transporting ATPase 4; organism: Rat; gene name: Atp2b4 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur