Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Polycomb protein SCMH1 (Sex comb on midleg homolog 1)

 SCMH1_HUMAN             Reviewed;         660 AA.
Q96GD3; B4DRQ8; Q5VT76; Q6IAJ4; Q8WU48; Q9UKM5; Q9UKM6;
01-MAR-2005, integrated into UniProtKB/Swiss-Prot.
01-DEC-2001, sequence version 1.
22-NOV-2017, entry version 143.
RecName: Full=Polycomb protein SCMH1;
AltName: Full=Sex comb on midleg homolog 1;
Name=SCMH1 {ECO:0000312|EMBL:CAH72793.1};
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1] {ECO:0000305, ECO:0000312|EMBL:AAF01150.1}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5), AND TISSUE SPECIFICITY.
TISSUE=Heart {ECO:0000312|EMBL:AAF01150.1}, and
Skeletal muscle {ECO:0000269|PubMed:10524249};
PubMed=10524249; DOI=10.1016/S0378-1119(99)00285-1;
Berger J., Kurahashi H., Takihara Y., Shimada K., Brock H.W.,
Randazzo F.;
"The human homolog of Sex comb on midleg (SCMH1) maps to chromosome
1p34.";
Gene 237:185-191(1999).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
TISSUE=Tongue;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[3] {ECO:0000305, ECO:0000312|EMBL:CAG33442.1}
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
"Cloning of human full open reading frames in Gateway(TM) system entry
vector (pDONR201).";
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
TISSUE=Fetal brain;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORM 2).
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[6] {ECO:0000305, ECO:0000312|EMBL:AAH21252.1}
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
TISSUE=Eye {ECO:0000312|EMBL:AAH21252.1}, and
Muscle {ECO:0000312|EMBL:AAH09752.1};
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
IDENTIFICATION BY MASS SPECTROMETRY, AND ASSOCIATION WITH A PRC1-LIKE
COMPLEX.
PubMed=12167701; DOI=10.1128/MCB.22.17.6070-6078.2002;
Levine S.S., Weiss A., Erdjument-Bromage H., Shao Z., Tempst P.,
Kingston R.E.;
"The core of the polycomb repressive complex is compositionally and
functionally conserved in flies and humans.";
Mol. Cell. Biol. 22:6070-6078(2002).
-!- FUNCTION: Associates with Polycomb group (PcG) multiprotein
complexes; the complex class is required to maintain the
transcriptionally repressive state of some genes. {ECO:0000250}.
-!- SUBUNIT: Interacts with the SAM domain of PHC1 via its SAM domain
in vitro (By similarity). Associates with a PRC1-like complex.
{ECO:0000250}.
-!- INTERACTION:
Q9UM19:HPCAL4; NbExp=4; IntAct=EBI-713793, EBI-744820;
P43365:MAGEA12; NbExp=3; IntAct=EBI-713793, EBI-749530;
Q9UMX0:UBQLN1; NbExp=3; IntAct=EBI-713793, EBI-741480;
Q9UMX0-2:UBQLN1; NbExp=3; IntAct=EBI-713793, EBI-10173939;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=6;
Name=1;
IsoId=Q96GD3-1; Sequence=Displayed;
Note=No experimental confirmation available. {ECO:0000305};
Name=2;
IsoId=Q96GD3-2; Sequence=VSP_051676, VSP_051679;
Note=Gene prediction confirmed by EST data.;
Name=3;
IsoId=Q96GD3-3; Sequence=VSP_051678;
Name=4 {ECO:0000269|PubMed:10524249};
IsoId=Q96GD3-4; Sequence=VSP_051677, VSP_051679;
Name=5 {ECO:0000269|PubMed:10524249};
IsoId=Q96GD3-5; Sequence=VSP_051678, VSP_051679;
Note=May be due to intron retention.
{ECO:0000303|PubMed:10524249};
Name=6;
IsoId=Q96GD3-6; Sequence=VSP_051677, VSP_043395, VSP_051679;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Strongly expressed in heart, muscle and
pancreas. Weakly expressed in brain, placenta, lung, liver and
kidney. {ECO:0000269|PubMed:10524249}.
-!- SIMILARITY: Belongs to the SCM family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF149045; AAF01150.1; -; mRNA.
EMBL; AF149046; AAF01151.1; -; mRNA.
EMBL; AK299383; BAG61370.1; -; mRNA.
EMBL; CR457161; CAG33442.1; -; mRNA.
EMBL; BX640721; CAE45840.1; -; mRNA.
EMBL; AL110502; CAI22109.1; -; Genomic_DNA.
EMBL; AL391730; CAI22109.1; JOINED; Genomic_DNA.
EMBL; AL110502; CAI22110.1; -; Genomic_DNA.
EMBL; AL391730; CAI22110.1; JOINED; Genomic_DNA.
EMBL; AL110502; CAI22111.1; -; Genomic_DNA.
EMBL; AL391730; CAI22111.1; JOINED; Genomic_DNA.
EMBL; AL606484; CAI22111.1; JOINED; Genomic_DNA.
EMBL; AL110502; CAI22112.1; -; Genomic_DNA.
EMBL; AL391730; CAI22112.1; JOINED; Genomic_DNA.
EMBL; AL110502; CAI22113.1; -; Genomic_DNA.
EMBL; AL391730; CAI22113.1; JOINED; Genomic_DNA.
EMBL; AL391730; CAH72791.1; -; Genomic_DNA.
EMBL; AL110502; CAH72791.1; JOINED; Genomic_DNA.
EMBL; AL391730; CAH72793.1; -; Genomic_DNA.
EMBL; AL110502; CAH72793.1; JOINED; Genomic_DNA.
EMBL; AL391730; CAH72794.1; -; Genomic_DNA.
EMBL; AL110502; CAH72794.1; JOINED; Genomic_DNA.
EMBL; AL606484; CAH72794.1; JOINED; Genomic_DNA.
EMBL; AL391730; CAH72795.1; -; Genomic_DNA.
EMBL; AL110502; CAH72795.1; JOINED; Genomic_DNA.
EMBL; AL391730; CAH72796.1; -; Genomic_DNA.
EMBL; AL110502; CAH72796.1; JOINED; Genomic_DNA.
EMBL; AL606484; CAH72242.1; -; Genomic_DNA.
EMBL; AL110502; CAH72242.1; JOINED; Genomic_DNA.
EMBL; AL391730; CAH72242.1; JOINED; Genomic_DNA.
EMBL; BC009752; AAH09752.1; -; mRNA.
EMBL; BC021252; AAH21252.1; -; mRNA.
CCDS; CCDS30688.1; -. [Q96GD3-1]
CCDS; CCDS461.1; -. [Q96GD3-4]
CCDS; CCDS53301.1; -. [Q96GD3-5]
CCDS; CCDS53302.1; -. [Q96GD3-3]
CCDS; CCDS53303.1; -. [Q96GD3-6]
CCDS; CCDS53304.1; -. [Q96GD3-2]
RefSeq; NP_001026864.1; NM_001031694.2. [Q96GD3-1]
RefSeq; NP_001165689.1; NM_001172218.1. [Q96GD3-5]
RefSeq; NP_001165690.1; NM_001172219.1. [Q96GD3-2]
RefSeq; NP_001165691.1; NM_001172220.1. [Q96GD3-5]
RefSeq; NP_001165692.1; NM_001172221.1. [Q96GD3-3]
RefSeq; NP_001165693.1; NM_001172222.2. [Q96GD3-6]
RefSeq; NP_036368.1; NM_012236.3. [Q96GD3-4]
RefSeq; XP_006710527.1; XM_006710464.1. [Q96GD3-3]
RefSeq; XP_011539335.1; XM_011541033.2. [Q96GD3-1]
RefSeq; XP_011539338.1; XM_011541036.2. [Q96GD3-3]
RefSeq; XP_016856188.1; XM_017000699.1. [Q96GD3-3]
RefSeq; XP_016856196.1; XM_017000707.1. [Q96GD3-6]
UniGene; Hs.571874; -.
PDB; 2P0K; X-ray; 1.75 A; A=27-238.
PDBsum; 2P0K; -.
ProteinModelPortal; Q96GD3; -.
SMR; Q96GD3; -.
BioGrid; 116609; 30.
CORUM; Q96GD3; -.
IntAct; Q96GD3; 21.
MINT; MINT-1422768; -.
STRING; 9606.ENSP00000318094; -.
DrugBank; DB03345; Beta-Mercaptoethanol.
iPTMnet; Q96GD3; -.
PhosphoSitePlus; Q96GD3; -.
BioMuta; SCMH1; -.
DMDM; 60390956; -.
MaxQB; Q96GD3; -.
PaxDb; Q96GD3; -.
PeptideAtlas; Q96GD3; -.
PRIDE; Q96GD3; -.
DNASU; 22955; -.
Ensembl; ENST00000326197; ENSP00000318094; ENSG00000010803. [Q96GD3-1]
Ensembl; ENST00000337495; ENSP00000337352; ENSG00000010803. [Q96GD3-2]
Ensembl; ENST00000361191; ENSP00000354656; ENSG00000010803. [Q96GD3-5]
Ensembl; ENST00000361705; ENSP00000354996; ENSG00000010803. [Q96GD3-4]
Ensembl; ENST00000372595; ENSP00000361676; ENSG00000010803. [Q96GD3-3]
Ensembl; ENST00000372596; ENSP00000361677; ENSG00000010803. [Q96GD3-5]
Ensembl; ENST00000372597; ENSP00000361678; ENSG00000010803. [Q96GD3-4]
Ensembl; ENST00000397171; ENSP00000380356; ENSG00000010803. [Q96GD3-5]
Ensembl; ENST00000397174; ENSP00000380359; ENSG00000010803. [Q96GD3-1]
Ensembl; ENST00000402904; ENSP00000386079; ENSG00000010803. [Q96GD3-3]
Ensembl; ENST00000456518; ENSP00000403974; ENSG00000010803. [Q96GD3-6]
GeneID; 22955; -.
KEGG; hsa:22955; -.
UCSC; uc001cgp.4; human. [Q96GD3-1]
CTD; 22955; -.
EuPathDB; HostDB:ENSG00000010803.16; -.
GeneCards; SCMH1; -.
HGNC; HGNC:19003; SCMH1.
HPA; HPA048898; -.
HPA; HPA053292; -.
MIM; 616396; gene.
neXtProt; NX_Q96GD3; -.
OpenTargets; ENSG00000010803; -.
PharmGKB; PA134870272; -.
eggNOG; ENOG410IMEZ; Eukaryota.
eggNOG; ENOG410XPKI; LUCA.
GeneTree; ENSGT00760000119024; -.
HOGENOM; HOG000236280; -.
HOVERGEN; HBG056406; -.
InParanoid; Q96GD3; -.
KO; K11461; -.
OMA; KILNNAM; -.
OrthoDB; EOG091G05BW; -.
PhylomeDB; Q96GD3; -.
TreeFam; TF106488; -.
Reactome; R-HSA-2559580; Oxidative Stress Induced Senescence.
Reactome; R-HSA-3108214; SUMOylation of DNA damage response and repair proteins.
Reactome; R-HSA-4551638; SUMOylation of chromatin organization proteins.
Reactome; R-HSA-4570464; SUMOylation of RNA binding proteins.
Reactome; R-HSA-8939243; RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known.
Reactome; R-HSA-8943724; Regulation of PTEN gene transcription.
ChiTaRS; SCMH1; human.
EvolutionaryTrace; Q96GD3; -.
GeneWiki; SCMH1; -.
GenomeRNAi; 22955; -.
PRO; PR:Q96GD3; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000010803; -.
CleanEx; HS_SCMH1; -.
ExpressionAtlas; Q96GD3; baseline and differential.
Genevisible; Q96GD3; HS.
GO; GO:0010369; C:chromocenter; IEA:Ensembl.
GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
GO; GO:0005634; C:nucleus; IC:UniProtKB.
GO; GO:0003677; F:DNA binding; TAS:ProtInc.
GO; GO:0003700; F:transcription factor activity, sequence-specific DNA binding; TAS:ProtInc.
GO; GO:0009653; P:anatomical structure morphogenesis; TAS:ProtInc.
GO; GO:0009952; P:anterior/posterior pattern specification; IEA:Ensembl.
GO; GO:0006338; P:chromatin remodeling; IEA:Ensembl.
GO; GO:0016458; P:gene silencing; ISS:UniProtKB.
GO; GO:0045892; P:negative regulation of transcription, DNA-templated; NAS:UniProtKB.
GO; GO:0007283; P:spermatogenesis; IEA:Ensembl.
GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
InterPro; IPR004092; Mbt.
InterPro; IPR001660; SAM.
InterPro; IPR013761; SAM/pointed_sf.
InterPro; IPR033763; SCML2_RBR.
InterPro; IPR021987; SLED.
Pfam; PF02820; MBT; 2.
Pfam; PF17208; RBR; 1.
Pfam; PF00536; SAM_1; 1.
Pfam; PF12140; SLED; 1.
SMART; SM00561; MBT; 2.
SMART; SM00454; SAM; 1.
SUPFAM; SSF47769; SSF47769; 1.
PROSITE; PS51079; MBT; 2.
PROSITE; PS50105; SAM_DOMAIN; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Complete proteome;
Developmental protein; Nucleus; Reference proteome; Repeat; Repressor;
Transcription; Transcription regulation.
CHAIN 1 660 Polycomb protein SCMH1.
/FTId=PRO_0000114334.
REPEAT 28 126 MBT 1.
REPEAT 134 235 MBT 2.
DOMAIN 593 658 SAM. {ECO:0000255|PROSITE-
ProRule:PRU00184}.
VAR_SEQ 1 61 Missing (in isoform 3 and isoform 5).
{ECO:0000303|PubMed:10524249,
ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:17974005,
ECO:0000303|Ref.3}.
/FTId=VSP_051678.
VAR_SEQ 1 48 MLVCYSVLACEILWDLPCSIMGSPLGHFTWDKYLKETCSVP
APVHCFK -> M (in isoform 4 and isoform
6). {ECO:0000303|PubMed:10524249,
ECO:0000303|PubMed:14702039}.
/FTId=VSP_051677.
VAR_SEQ 1 24 MLVCYSVLACEILWDLPCSIMGSP -> MQPNVIDWSDVRK
HKYGHLSESASQYQEAADILD (in isoform 2).
{ECO:0000305}.
/FTId=VSP_051676.
VAR_SEQ 128 238 Missing (in isoform 6).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_043395.
VAR_SEQ 550 571 Missing (in isoform 2, isoform 4, isoform
5 and isoform 6).
{ECO:0000303|PubMed:10524249,
ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:17974005}.
/FTId=VSP_051679.
CONFLICT 463 463 F -> L (in Ref. 3). {ECO:0000305}.
HELIX 30 36 {ECO:0000244|PDB:2P0K}.
HELIX 44 46 {ECO:0000244|PDB:2P0K}.
STRAND 47 49 {ECO:0000244|PDB:2P0K}.
STRAND 63 68 {ECO:0000244|PDB:2P0K}.
STRAND 71 84 {ECO:0000244|PDB:2P0K}.
STRAND 87 92 {ECO:0000244|PDB:2P0K}.
STRAND 101 104 {ECO:0000244|PDB:2P0K}.
HELIX 115 118 {ECO:0000244|PDB:2P0K}.
HELIX 133 135 {ECO:0000244|PDB:2P0K}.
HELIX 136 144 {ECO:0000244|PDB:2P0K}.
HELIX 152 154 {ECO:0000244|PDB:2P0K}.
STRAND 172 176 {ECO:0000244|PDB:2P0K}.
STRAND 184 193 {ECO:0000244|PDB:2P0K}.
STRAND 196 201 {ECO:0000244|PDB:2P0K}.
TURN 205 208 {ECO:0000244|PDB:2P0K}.
STRAND 210 213 {ECO:0000244|PDB:2P0K}.
HELIX 224 228 {ECO:0000244|PDB:2P0K}.
SEQUENCE 660 AA; 73354 MW; 6544DD484DA8D037 CRC64;
MLVCYSVLAC EILWDLPCSI MGSPLGHFTW DKYLKETCSV PAPVHCFKQS YTPPSNEFKI
SMKLEAQDPR NTTSTCIATV VGLTGARLRL RLDGSDNKND FWRLVDSAEI QPIGNCEKNG
GMLQPPLGFR LNASSWPMFL LKTLNGAEMA PIRIFHKEPP SPSHNFFKMG MKLEAVDRKN
PHFICPATIG EVRGSEVLVT FDGWRGAFDY WCRFDSRDIF PVGWCSLTGD NLQPPGTKVV
IPKNPYPASD VNTEKPSIHS STKTVLEHQP GQRGRKPGKK RGRTPKTLIS HPISAPSKTA
EPLKFPKKRG PKPGSKRKPR TLLNPPPASP TTSTPEPDTS TVPQDAATIP SSAMQAPTVC
IYLNKNGSTG PHLDKKKVQQ LPDHFGPARA SVVLQQAVQA CIDCAYHQKT VFSFLKQGHG
GEVISAVFDR EQHTLNLPAV NSITYVLRFL EKLCHNLRSD NLFGNQPFTQ THLSLTAIEY
SHSHDRYLPG ETFVLGNSLA RSLEPHSDSM DSASNPTNLV STSQRHRPLL SSCGLPPSTA
SAVRRLCSRG VLKGSNERRD MESFWKLNRS PGSDRYLESR DASRLSGRDP SSWTVEDVMQ
FVREADPQLG PHADLFRKHE IDGKALLLLR SDMMMKYMGL KLGPALKLSY HIDRLKQGKF


Related products :

Catalog number Product name Quantity
EIAAB37569 Mouse,Mus musculus,Polycomb protein SCMH1,Scmh1,Sex comb on midleg homolog 1
EIAAB37570 Homo sapiens,Human,Polycomb protein SCMH1,SCMH1,Sex comb on midleg homolog 1
SCMH1 SCMH1 Gene sex comb on midleg homolog 1 (Drosophila)
201-20-5130 SCMH1{sex comb on midleg homolog 1 (Drosophila)}rabbit.pAb 0.2ml
CSB-EL020828MO Mouse sex comb on midleg homolog 1 (Drosophila) (SCMH1) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-EL020828HU Human sex comb on midleg homolog 1 (Drosophila) (SCMH1) ELISA kit, Species Human, Sample Type serum, plasma 96T
SCMH1_MOUSE ELISA Kit FOR Polycomb protein SCMH1; organism: Mouse; gene name: Scmh1 96T
CSB-EL020828HU Human Polycomb protein SCMH1(SCMH1) ELISA kit SpeciesHuman 96T
CSB-EL020828MO Mouse Polycomb protein SCMH1(SCMH1) ELISA kit SpeciesMouse 96T
CSB-EL020828HU Human Polycomb protein SCMH1(SCMH1) ELISA kit 96T
CSB-EL020828MO Mouse Polycomb protein SCMH1(SCMH1) ELISA kit 96T
20-372-60106 sex comb on midleg-like 2 (Drosophila) (SCML2). mRNA - Mouse monoclonal anti-human SCML2 antibody; Drosophila; Sex comb on midleg-like 2 (Drosophila). isoform CRA_a Monoclonal 0.1 mg
E5547h Human Sex Comb On Midleg Like Protein 1 ELISA Kit 96T
E5546h Human Sex Comb On Midleg Like Protein 2 ELISA Kit 96T
CA180_HUMAN Mouse ELISA Kit FOR Sex comb on midleg-like protein 4 96T
E0295Rb Mouse ELISA Kit FOR Sex comb on midleg-like protein 4 96T
U2D2L_HUMAN Human ELISA Kit FOR Sex comb on midleg-like protein 2 96T
CN038_HUMAN Human ELISA Kit FOR Sex comb on midleg-like protein 2 96T
E8002h Human Sex Comb On Midleg Like Protein 3 ELISA Kit 96T
E0052m Human ELISA Kit FOR Sex comb on midleg-like protein 2 96T
NIT2_RAT Mouse ELISA Kit FOR Sex comb on midleg-like protein 4 96T
E6675h Human Sex Comb On Midleg Like Protein 4 ELISA Kit 96T
CSB-EL020831MO Mouse Sex comb on midleg-like protein 4(SCML4) ELISA kit 96T
CSB-EL020831HU Human Sex comb on midleg-like protein 4(SCML4) ELISA kit 96T
CSB-EL020829HU Human Sex comb on midleg-like protein 1(SCML1) ELISA kit 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur