Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Potassium channel subfamily K member 17 (2P domain potassium channel Talk-2) (Acid-sensitive potassium channel protein TASK-4) (TWIK-related acid-sensitive K( ) channel 4) (TWIK-related alkaline pH-activated K( ) channel 2) (TALK-2)

 KCNKH_HUMAN             Reviewed;         332 AA.
Q96T54; E9PB46; Q5TCF4; Q8TAW4; Q9BXD1; Q9H592;
01-NOV-2002, integrated into UniProtKB/Swiss-Prot.
01-DEC-2001, sequence version 1.
25-OCT-2017, entry version 143.
RecName: Full=Potassium channel subfamily K member 17;
AltName: Full=2P domain potassium channel Talk-2;
AltName: Full=Acid-sensitive potassium channel protein TASK-4;
AltName: Full=TWIK-related acid-sensitive K(+) channel 4;
AltName: Full=TWIK-related alkaline pH-activated K(+) channel 2;
Short=TALK-2;
Name=KCNK17; Synonyms=TALK2, TASK4; ORFNames=UNQ5816/PRO19634;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA].
TISSUE=Pancreas;
PubMed=11263999; DOI=10.1006/bbrc.2001.4562;
Girard C., Duprat F., Terrenoire C., Tinel N., Fosset M., Romey G.,
Lazdunski M., Lesage F.;
"Genomic and functional characteristics of novel human pancreatic 2P
domain K(+) channels.";
Biochem. Biophys. Res. Commun. 282:249-256(2001).
[2]
NUCLEOTIDE SEQUENCE [MRNA], AND VARIANT GLY-21.
TISSUE=Adrenal gland;
PubMed=11248242; DOI=10.1016/S0014-5793(01)02222-0;
Decher N., Maier M., Dittrich W., Gassenhuber J., Brueggemann A.,
Busch A.E., Steinmeyer K.;
"Characterization of TASK-4, a novel member of the pH-sensitive, two-
pore domain potassium channel family.";
FEBS Lett. 492:84-89(2001).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=14574404; DOI=10.1038/nature02055;
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L.,
Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E.,
Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R.,
Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S.,
Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J.,
Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P.,
Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y.,
Burford D.C., Burrill W., Burton J., Carder C., Carter N.P.,
Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V.,
Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J.,
Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E.,
Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A.,
Frankland J., French L., Garner P., Garnett J., Ghori M.J.,
Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M.,
Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S.,
Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R.,
Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E.,
Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A.,
Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C.,
Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M.,
Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M.,
Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K.,
McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T.,
Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R.,
Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W.,
Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M.,
Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L.,
Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J.,
Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B.,
Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L.,
Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W.,
Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A.,
Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.;
"The DNA sequence and analysis of human chromosome 6.";
Nature 425:805-811(2003).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA], AND VARIANT GLY-21.
TISSUE=Lung, and Spleen;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
-!- FUNCTION: Outward rectifying potassium channel. Produces rapidly
activating and non-inactivating outward rectifier K(+) currents.
-!- SUBUNIT: Homodimer. {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q96T54-3; Sequence=Displayed;
Name=2;
IsoId=Q96T54-4; Sequence=VSP_047354;
Note=No experimental confirmation available. Gene prediction
based on EST data.;
-!- MISCELLANEOUS: Inhibited by Ba(2+), quinidine, chloroform and
halothane. Activated at alkaline pH. Activated by quinine and
isoflurane.
-!- SIMILARITY: Belongs to the two pore domain potassium channel (TC
1.A.1.8) family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAK28551.1; Type=Frameshift; Positions=260; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF358910; AAK49533.1; -; mRNA.
EMBL; AF339912; AAK28551.1; ALT_FRAME; mRNA.
EMBL; AY358853; AAQ89212.1; -; mRNA.
EMBL; AL136087; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC025726; AAH25726.1; -; mRNA.
CCDS; CCDS47419.1; -. [Q96T54-4]
CCDS; CCDS4842.1; -. [Q96T54-3]
RefSeq; NP_001128583.1; NM_001135111.1. [Q96T54-4]
RefSeq; NP_113648.2; NM_031460.3. [Q96T54-3]
UniGene; Hs.162282; -.
ProteinModelPortal; Q96T54; -.
BioGrid; 124608; 1.
STRING; 9606.ENSP00000362328; -.
TCDB; 1.A.1.9.6; the voltage-gated ion channel (vic) superfamily.
BioMuta; KCNK17; -.
DMDM; 24636280; -.
PaxDb; Q96T54; -.
PeptideAtlas; Q96T54; -.
PRIDE; Q96T54; -.
DNASU; 89822; -.
Ensembl; ENST00000373231; ENSP00000362328; ENSG00000124780. [Q96T54-3]
Ensembl; ENST00000453413; ENSP00000401271; ENSG00000124780. [Q96T54-4]
GeneID; 89822; -.
KEGG; hsa:89822; -.
UCSC; uc003ooo.4; human. [Q96T54-3]
CTD; 89822; -.
DisGeNET; 89822; -.
EuPathDB; HostDB:ENSG00000124780.13; -.
GeneCards; KCNK17; -.
HGNC; HGNC:14465; KCNK17.
HPA; HPA043892; -.
MIM; 607370; gene.
neXtProt; NX_Q96T54; -.
OpenTargets; ENSG00000124780; -.
PharmGKB; PA30058; -.
eggNOG; KOG1418; Eukaryota.
eggNOG; COG1226; LUCA.
GeneTree; ENSGT00760000118858; -.
HOGENOM; HOG000074161; -.
HOVERGEN; HBG052240; -.
InParanoid; Q96T54; -.
KO; K04925; -.
OMA; SMGRWEF; -.
OrthoDB; EOG091G08DF; -.
PhylomeDB; Q96T54; -.
TreeFam; TF313947; -.
Reactome; R-HSA-1299361; TWIK-related alkaline pH activated K+ channel (TALK).
Reactome; R-HSA-5576886; Phase 4 - resting membrane potential.
GeneWiki; KCNK17; -.
GenomeRNAi; 89822; -.
PRO; PR:Q96T54; -.
Proteomes; UP000005640; Chromosome 6.
Bgee; ENSG00000124780; -.
CleanEx; HS_KCNK17; -.
Genevisible; Q96T54; HS.
GO; GO:0005887; C:integral component of plasma membrane; IBA:GO_Central.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0005267; F:potassium channel activity; IDA:UniProtKB.
GO; GO:0022841; F:potassium ion leak channel activity; IBA:GO_Central.
GO; GO:0005244; F:voltage-gated ion channel activity; IEA:UniProtKB-KW.
GO; GO:0006813; P:potassium ion transport; IDA:UniProtKB.
GO; GO:0030322; P:stabilization of membrane potential; IBA:GO_Central.
InterPro; IPR003280; 2pore_dom_K_chnl.
InterPro; IPR003092; 2pore_dom_K_chnl_TASK.
InterPro; IPR013099; K_chnl_dom.
Pfam; PF07885; Ion_trans_2; 2.
PIRSF; PIRSF038061; K_channel_subfamily_K_type; 1.
PRINTS; PR01333; 2POREKCHANEL.
PRINTS; PR01095; TASKCHANNEL.
2: Evidence at transcript level;
Alternative splicing; Complete proteome; Glycoprotein; Ion channel;
Ion transport; Membrane; Polymorphism; Potassium; Potassium channel;
Potassium transport; Reference proteome; Transmembrane;
Transmembrane helix; Transport; Voltage-gated channel.
CHAIN 1 332 Potassium channel subfamily K member 17.
/FTId=PRO_0000101768.
TOPO_DOM 1 20 Cytoplasmic. {ECO:0000255}.
TRANSMEM 21 43 Helical. {ECO:0000255}.
INTRAMEM 106 124 Pore-forming; Name=Pore-forming 1.
{ECO:0000255}.
TRANSMEM 128 148 Helical. {ECO:0000255}.
TOPO_DOM 149 179 Cytoplasmic. {ECO:0000255}.
TRANSMEM 180 200 Helical. {ECO:0000255}.
INTRAMEM 211 230 Pore-forming; Name=Pore-forming 2.
{ECO:0000255}.
TRANSMEM 244 264 Helical. {ECO:0000255}.
TOPO_DOM 265 332 Cytoplasmic. {ECO:0000255}.
CARBOHYD 65 65 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 94 94 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 230 332 GMNPSQRYPLWYKNMVSLWILFGMAWLALIIKLILSQLETP
GRVCSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEG
PMGIIQHLEPSAHAAGCGKDS -> ASCLISDTRKPNRDWQ
TLERTSKSSGGLLKYRFLAGHGGSHL (in isoform
2). {ECO:0000305}.
/FTId=VSP_047354.
VARIANT 21 21 S -> G (in dbSNP:rs10947804).
{ECO:0000269|PubMed:11248242,
ECO:0000269|PubMed:15489334}.
/FTId=VAR_032362.
VARIANT 253 253 M -> L (in dbSNP:rs35677794).
/FTId=VAR_032363.
VARIANT 296 296 R -> Q (in dbSNP:rs2758910).
/FTId=VAR_024683.
SEQUENCE 332 AA; 36895 MW; 1848DBC06E078158 CRC64;
MYRPRARAAP EGRVRGCAVP STVLLLLAYL AYLALGTGVF WTLEGRAAQD SSRSFQRDKW
ELLQNFTCLD RPALDSLIRD VVQAYKNGAS LLSNTTSMGR WELVGSFFFS VSTITTIGYG
NLSPNTMAAR LFCIFFALVG IPLNLVVLNR LGHLMQQGVN HWASRLGGTW QDPDKARWLA
GSGALLSGLL LFLLLPPLLF SHMEGWSYTE GFYFAFITLS TVGFGDYVIG MNPSQRYPLW
YKNMVSLWIL FGMAWLALII KLILSQLETP GRVCSCCHHS SKEDFKSQSW RQGPDREPES
HSPQQGCYPE GPMGIIQHLE PSAHAAGCGK DS


Related products :

Catalog number Product name Quantity
18-003-42620 Potassium channel subfamily K member 3 - Acid-sensitive potassium channel protein TASK-1; TWIK-related acid-sensitive K(+) channel 1; Two pore potassium channel KT3.1 Polyclonal 0.1 mg Protein A
18-003-43175 Potassium channel subfamily K member 5 - Acid-sensitive potassium channel protein TASK-2; TWIK-related acid-sensitive K(+) channel 2 Polyclonal 0.05 mg Aff Pur
18-003-42653 Potassium channel subfamily K member 10 - Outward rectifying potassium channel protein TREK-2; TREK-2 K(+) channel subunit Polyclonal 0.1 mg Protein A
18-003-42641 Potassium channel subfamily K member 10 - Outward rectifying potassium channel protein TREK-2; TREK-2 K(+) channel subunit Polyclonal 0.1 mg Protein A
18-003-42642 Potassium channel subfamily K member 10 - Outward rectifying potassium channel protein TREK-2; TREK-2 K(+) channel subunit Polyclonal 0.1 mg Protein A
AI80006A Twik Related Potassium Channel 1 Protein (TREK-1) Primary antibodies 0.1 mg
18-003-42631 Cyclic GMP gated potassium channel - Potassium voltage-gated channel. shaker-related subfamily. member 10 Polyclonal 0.1 mg Protein A
18-003-42648 Potassium channel subfamily K member 13 - Tandem pore domain halothane-inhibited potassium channel 1; THIK-1 Polyclonal 0.05 mg Aff Pur
18-003-42649 Potassium channel subfamily K member 13 - Tandem pore domain halothane-inhibited potassium channel 1; THIK-1 Polyclonal 0.1 mg Protein A
Y062359 Anti-Potassium Channel Kv<_SUB>1.3 (Charybdotoxin-Sensitive Voltage-Dependent Potassium Channel, HLK3) produced in rabbit Antibody 100ul
AI80006A Twik Related Potassium Channel 1 Protein (TREK-1), Polyclonal Antibodies to Signal Transduction, Purified, Host: Rabbit 0.5 mg
AI80006A Twik Related Potassium Channel 1 Protein (TREK-1), Polyclonal Antibodies to Signal Transduction, Host:Rabbit, Purified 0.5 mg
AI80006A Twik Related Potassium Channel 1 Protein (TREK-1), Polyclonal Antibodies to Signal Transduction, Host:Rabbit, Purified 0.1 mg
AI80006A Twik Related Potassium Channel 1 Protein (TREK-1), Polyclonal Antibodies to Signal Transduction, Purified, Host: Rabbit 0.1 mg
18-003-42664 Potassium voltage-gated channel subfamily KQT member 2 - Voltage-gated potassium channel subunit Kv7.2; Neuroblastoma-specific potassium channel subunit alpha KvLQT2; KQT-like 2 Polyclonal 0.1 mg Protein A
18-003-42663 Potassium voltage-gated channel subfamily KQT member 2 - Voltage-gated potassium channel subunit Kv7.2; Neuroblastoma-specific potassium channel subunit alpha KvLQT2; KQT-like 2 Polyclonal 0.05 mg Aff Pur
18-783-75527 RABBIT ANTI HUMAN KCNMB3 (C-TERMINAL) - POTASSIUM LARGE CONDUCTANCE CALCIUM-ACTIVATED CHANNEL. SUBFAMILY M BETA MEMBER 3; Calcium-activated potassium channel. subfamily M subunit beta-3; Maxi K channe 0.05 mg
18-003-42669 Kv channel-interacting protein 2 - KChIP2; A-type potassium channel modulatory protein 2; Potassium channel-interacting protein 2; Cardiac voltage-gated potassium channel modulatory subunit Polyclonal 0.05 mg Aff Pur
18-003-42670 Kv channel-interacting protein 2 - KChIP2; A-type potassium channel modulatory protein 2; Potassium channel-interacting protein 2; Cardiac voltage-gated potassium channel modulatory subunit Polyclonal 0.05 mg Aff Pur
AI80006A Polyclonal Antibodies to Signal Transduction Twik Related Potassium Channel 1 Protein (TREK-1), anti-human, Format Purified , Host Rabbit 0.5 mg
AI80006A Polyclonal Antibodies to Signal Transduction Twik Related Potassium Channel 1 Protein (TREK-1), anti-human, Format Purified , Host Rabbit 0.1 mg
Y062377 Anti-Potassium Channel KCa<_SUB>3.1 (Intermediate-conductance Ca2+<_SUP>-activated Potassium Channel 4) produced in rabbit Antibody 100ul
18-003-42628 Amiloride-sensitive cation channel 3 - Acid-sensing ion channel 3; ASIC3; hASIC3; Testis sodium channel 1; hTNaC1 Polyclonal 0.1 mg Protein A
Y062378 Anti-Potassium Channel KCa<_SUB>2.3, (C-term) (Small-conductance Ca2+<_SUP>-activated Potassium Channel 3) produced in rabbit Antibody 100ul
28-238 KCNK3 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The gene product is an outwardly rectifying channel that is sensitive to change 0.1 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur